Recombinant Human GRN protein(491-570 aa), C-His-tagged

• Cat.No.: GRN-2709H
• Product Overview: Recombinant Human GRN protein(P28799)(491-570 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 491-570 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGT

Gene Information

• Gene Name: GRN granulin [ Homo sapiens ]
• Official Symbol: GRN
• Synonyms: GRN; granulin; granulins; CLN11; PCDGF; PGRN; progranulin; acrogranin; proepithelin; granulin-epithelin; PC cell-derived growth factor; GEP; GP88; PEPI
• Gene ID: 2896
• mRNA Refseq: NM_002087
• Protein Refseq: NP_002078
• MIM: 138945
• UniProt ID: P28799