Recombinant Human GRN protein(491-570 aa), C-His-tagged
Cat.No. : | GRN-2709H |
Product Overview : | Recombinant Human GRN protein(P28799)(491-570 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 491-570 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KARSCEKEVVSAQPATFLARSPHVGVKDVECGEGHFCHDNQTCCRDNRQGWACCPYRQGVCCADRRHCCPAGFRCAARGT |
Gene Name | GRN granulin [ Homo sapiens ] |
Official Symbol | GRN |
Synonyms | GRN; granulin; granulins; CLN11; PCDGF; PGRN; progranulin; acrogranin; proepithelin; granulin-epithelin; PC cell-derived growth factor; GEP; GP88; PEPI; |
Gene ID | 2896 |
mRNA Refseq | NM_002087 |
Protein Refseq | NP_002078 |
MIM | 138945 |
UniProt ID | P28799 |
◆ Recombinant Proteins | ||
GRN-726H | Recombinant Human GRN protein, His-tagged | +Inquiry |
GRN-7847H | Recombinant Human GRN protein, His & S-tagged | +Inquiry |
GRN-1022H | Recombinant Human GRN Protein, His (Fc)-Avi-tagged | +Inquiry |
GRN-3063H | Recombinant Human GRN Protein (Thr18-Asp363), N-His tagged | +Inquiry |
Grn-469R | Recombinant Rat Grn, FLAG-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRN-2412MCL | Recombinant Mouse GRN cell lysate | +Inquiry |
GRN-2791HCL | Recombinant Human GRN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRN Products
Required fields are marked with *
My Review for All GRN Products
Required fields are marked with *