Recombinant Human GRPEL1 Protein, GST-tagged
Cat.No. : | GRPEL1-5380H |
Product Overview : | Human GRPEL1 full-length ORF ( NP_079472.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GRPEL1 (GrpE Like 1, Mitochondrial) is a Protein Coding gene. Diseases associated with GRPEL1 include Human Monocytic Ehrlichiosis and Ehrlichiosis. Among its related pathways are Metabolism of proteins and Mitochondrial protein import. GO annotations related to this gene include protein homodimerization activity and chaperone binding. An important paralog of this gene is GRPEL2. |
Molecular Mass : | 50.7 kDa |
AA Sequence : | MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRPEL1 GrpE-like 1, mitochondrial (E. coli) [ Homo sapiens ] |
Official Symbol | GRPEL1 |
Synonyms | GRPEL1; GrpE-like 1, mitochondrial (E. coli); grpE protein homolog 1, mitochondrial; FLJ25609; HMGE; mt-GrpE#1; GrpE-like protein cochaperone; |
Gene ID | 80273 |
mRNA Refseq | NM_025196 |
Protein Refseq | NP_079472 |
MIM | 606173 |
UniProt ID | Q9HAV7 |
◆ Recombinant Proteins | ||
GRPEL1-2376R | Recombinant Rat GRPEL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRPEL1-5604HF | Recombinant Full Length Human GRPEL1 Protein, GST-tagged | +Inquiry |
GRPEL1-568C | Recombinant Cynomolgus GRPEL1 Protein, His-tagged | +Inquiry |
GRPEL1-2840H | Recombinant Human GrpE-like 1, Mitochondrial (E. coli), His-tagged | +Inquiry |
GRPEL1-314C | Recombinant Cynomolgus Monkey GRPEL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRPEL1-754HCL | Recombinant Human GRPEL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRPEL1 Products
Required fields are marked with *
My Review for All GRPEL1 Products
Required fields are marked with *