"GRPEL1" Related Products

Expand

Recombinant Human GRPEL1 Protein, GST-tagged

Cat.No. : GRPEL1-5380H
Product Overview : Human GRPEL1 full-length ORF ( NP_079472.1, 1 a.a. - 217 a.a.) recombinant protein with GST-tag at N-terminal.
Description : GRPEL1 (GrpE Like 1, Mitochondrial) is a Protein Coding gene. Diseases associated with GRPEL1 include Human Monocytic Ehrlichiosis and Ehrlichiosis. Among its related pathways are Metabolism of proteins and Mitochondrial protein import. GO annotations related to this gene include protein homodimerization activity and chaperone binding. An important paralog of this gene is GRPEL2.
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 50.7 kDa
AA Sequence : MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Quality Control Testing :

12.5% SDS-PAGE Stained with Coomassie Blue.

Gene Name : GRPEL1 GrpE-like 1, mitochondrial (E. coli) [ Homo sapiens ]
Official Symbol : GRPEL1
Synonyms : GRPEL1; GrpE-like 1, mitochondrial (E. coli); grpE protein homolog 1, mitochondrial; FLJ25609; HMGE; mt-GrpE#1; GrpE-like protein cochaperone;
Gene ID : 80273
mRNA Refseq : NM_025196
Protein Refseq : NP_079472
MIM : 606173
UniProt ID : Q9HAV7

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.