Recombinant Human GRPEL1 protein, GST-tagged
| Cat.No. : | GRPEL1-301516H |
| Product Overview : | Recombinant Human GRPEL1 (1-217 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Met1-Ala217 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Gene Name | GRPEL1 GrpE-like 1, mitochondrial (E. coli) [ Homo sapiens ] |
| Official Symbol | GRPEL1 |
| Synonyms | GRPEL1; GrpE-like 1, mitochondrial (E. coli); grpE protein homolog 1, mitochondrial; FLJ25609; HMGE; mt-GrpE#1; GrpE-like protein cochaperone; |
| Gene ID | 80273 |
| mRNA Refseq | NM_025196 |
| Protein Refseq | NP_079472 |
| MIM | 606173 |
| UniProt ID | Q9HAV7 |
| ◆ Recombinant Proteins | ||
| GRPEL1-301516H | Recombinant Human GRPEL1 protein, GST-tagged | +Inquiry |
| GRPEL1-2840H | Recombinant Human GrpE-like 1, Mitochondrial (E. coli), His-tagged | +Inquiry |
| GRPEL1-1800R | Recombinant Rhesus Macaque GRPEL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRPEL1-2376R | Recombinant Rat GRPEL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GRPEL1-2722R | Recombinant Rat GRPEL1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GRPEL1-754HCL | Recombinant Human GRPEL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRPEL1 Products
Required fields are marked with *
My Review for All GRPEL1 Products
Required fields are marked with *



