Recombinant Human GRPEL1 protein, GST-tagged

• Cat.No.: GRPEL1-301516H
• Product Overview: Recombinant Human GRPEL1 (1-217 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Ala217
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: GRPEL1 GrpE-like 1, mitochondrial (E. coli) [ Homo sapiens ]
• Official Symbol: GRPEL1
• Synonyms: GRPEL1; GrpE-like 1, mitochondrial (E. coli); grpE protein homolog 1, mitochondrial; FLJ25609; HMGE; mt-GrpE#1; GrpE-like protein cochaperone
• Gene ID: 80273
• mRNA Refseq: NM_025196
• Protein Refseq: NP_079472
• MIM: 606173
• UniProt ID: Q9HAV7