Recombinant Human GSPT1 protein, His-tagged
Cat.No. : | GSPT1-6788H |
Product Overview : | Recombinant Human GSPT1 protein(294-499 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 294-499 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | FNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | GSPT1 G1 to S phase transition 1 [ Homo sapiens ] |
Official Symbol | GSPT1 |
Synonyms | GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067; |
Gene ID | 2935 |
mRNA Refseq | NM_001130006 |
Protein Refseq | NP_001123478 |
MIM | 139259 |
UniProt ID | P15170 |
◆ Recombinant Proteins | ||
GSPT1-3873C | Recombinant Chicken GSPT1 | +Inquiry |
GSPT1-938H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
GSPT1-940H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
GSPT1-941H | Recombinant Human GSPT1 protein, His-tagged | +Inquiry |
GSPT1-1191Z | Recombinant Zebrafish GSPT1 | +Inquiry |
◆ Native Proteins | ||
GSPT1-12HFL | Recombinant Full Length Human GSPT1 Protein, Avi tagged, Biotin Labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSPT1 Products
Required fields are marked with *
My Review for All GSPT1 Products
Required fields are marked with *