Recombinant Human GSPT1 protein, His-tagged
| Cat.No. : | GSPT1-6788H |
| Product Overview : | Recombinant Human GSPT1 protein(294-499 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 294-499 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | FNRSVDGPIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGENLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCIEEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLRDEGKTIAIGKVLKLVPEKD |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | GSPT1 G1 to S phase transition 1 [ Homo sapiens ] |
| Official Symbol | GSPT1 |
| Synonyms | GSPT1; G1 to S phase transition 1; eukaryotic peptide chain release factor GTP-binding subunit ERF3A; eRF3a; ETF3A; GST1; G1 to S phase transition protein 1 homolog; eukaryotic peptide chain release factor subunit 3a; 551G9.2; FLJ38048; FLJ39067; |
| Gene ID | 2935 |
| mRNA Refseq | NM_001130006 |
| Protein Refseq | NP_001123478 |
| MIM | 139259 |
| UniProt ID | P15170 |
| ◆ Recombinant Proteins | ||
| GSPT1-621HF | Recombinant Full Length Human GSPT1 Protein, GST-tagged | +Inquiry |
| GSPT1-1191Z | Recombinant Zebrafish GSPT1 | +Inquiry |
| GSPT1-909H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
| GSPT1-6789H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
| GSPT1-938H | Recombinant Human GSPT1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GSPT1 Products
Required fields are marked with *
My Review for All GSPT1 Products
Required fields are marked with *
