Recombinant Human GTF2I

Cat.No. : GTF2I-29514TH
Product Overview : Recombinant full length Human TFII I, amino acids 1-274 according to AAH04472, with N terminal proprietary tag; predicted MW: 55.88 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 274 amino acids
Description : This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7, 13 and 21.
Molecular Weight : 55.880kDa inclusive of tags
Tissue specificity : Ubiquitous. Isoform 1 is strongly expressed in fetal brain, weakly in adult brain, muscle, and lymphoblasts and is almost undetectable in other adult tissues, while the other isoforms are equally expressed in all adult tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKS KAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYC VEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYF CFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFK HPENYDLATLKWILENKAGVSFIIKRPFLEPKKHVGGRVM VTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVK EESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG
Sequence Similarities : Belongs to the TFII-I family.Contains 6 GTF2I-like repeats.
Gene Name GTF2I general transcription factor IIi [ Homo sapiens ]
Official Symbol GTF2I
Synonyms GTF2I; general transcription factor IIi; general transcription factor II, i , WBSCR6; general transcription factor II-I; BAP 135; BTKAP1; DIWS; IB291; SPIN; TFII I;
Gene ID 2969
mRNA Refseq NM_001163636
Protein Refseq NP_001157108
MIM 601679
Uniprot ID P78347
Chromosome Location 7q11.23
Pathway B Cell Receptor Signaling Pathway, organism-specific biosystem; Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem;
Function DNA binding; mitogen-activated protein kinase binding; protein binding; sequence-specific DNA binding transcription factor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GTF2I Products

Required fields are marked with *

My Review for All GTF2I Products

Required fields are marked with *

0
cart-icon
0
compare icon