Recombinant Human GTF2I
Cat.No. : | GTF2I-29514TH |
Product Overview : | Recombinant full length Human TFII I, amino acids 1-274 according to AAH04472, with N terminal proprietary tag; predicted MW: 55.88 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 274 amino acids |
Description : | This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7, 13 and 21. |
Molecular Weight : | 55.880kDa inclusive of tags |
Tissue specificity : | Ubiquitous. Isoform 1 is strongly expressed in fetal brain, weakly in adult brain, muscle, and lymphoblasts and is almost undetectable in other adult tissues, while the other isoforms are equally expressed in all adult tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKS KAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYC VEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYF CFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFK HPENYDLATLKWILENKAGVSFIIKRPFLEPKKHVGGRVM VTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVK EESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG |
Sequence Similarities : | Belongs to the TFII-I family.Contains 6 GTF2I-like repeats. |
Gene Name | GTF2I general transcription factor IIi [ Homo sapiens ] |
Official Symbol | GTF2I |
Synonyms | GTF2I; general transcription factor IIi; general transcription factor II, i , WBSCR6; general transcription factor II-I; BAP 135; BTKAP1; DIWS; IB291; SPIN; TFII I; |
Gene ID | 2969 |
mRNA Refseq | NM_001163636 |
Protein Refseq | NP_001157108 |
MIM | 601679 |
Uniprot ID | P78347 |
Chromosome Location | 7q11.23 |
Pathway | B Cell Receptor Signaling Pathway, organism-specific biosystem; Basal transcription factors, organism-specific biosystem; Basal transcription factors, conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; |
Function | DNA binding; mitogen-activated protein kinase binding; protein binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
GTF2I-15H | Recombinant Human GTF2I Protein (1-976), N-GST-tagged | +Inquiry |
GTF2I-13601H | Recombinant Human GTF2I, GST-tagged | +Inquiry |
GTF2I-1831R | Recombinant Rhesus Macaque GTF2I Protein, His (Fc)-Avi-tagged | +Inquiry |
GTF2I-2745R | Recombinant Rat GTF2I Protein | +Inquiry |
GTF2I-29513TH | Recombinant Human GTF2I | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2I-763HCL | Recombinant Human GTF2I cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTF2I Products
Required fields are marked with *
My Review for All GTF2I Products
Required fields are marked with *