Recombinant Human GTPBP2 Protein, GST-tagged
Cat.No. : | GTPBP2-4471H |
Product Overview : | Human GTPBP2 partial ORF ( NP_061969, 67 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GTP-binding proteins, or G proteins, constitute a superfamily capable of binding GTP or GDP. G proteins are activated by binding GTP and are inactivated by hydrolyzing GTP to GDP. This general mechanism enables G proteins to perform a wide range of biologic activities.[supplied by OMIM |
Molecular Mass : | 37.4 kDa |
AA Sequence : | NIEYKLKLVNPSQYRFEHLVTQMKWRLQEGRGEAVYQIGVEDNGLLVGLAEEEMRASLKTLHRMAEKVGADITVLREREVDYDSDMPRKITEVLVRKVPDNQQFLD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GTPBP2 GTP binding protein 2 [ Homo sapiens ] |
Official Symbol | GTPBP2 |
Synonyms | GTPBP2; GTP binding protein 2; GTP-binding protein 2; MGC74725; |
Gene ID | 54676 |
mRNA Refseq | NM_019096 |
Protein Refseq | NP_061969 |
MIM | 607434 |
UniProt ID | Q9BX10 |
◆ Recombinant Proteins | ||
GTPBP2-7374M | Recombinant Mouse GTPBP2 Protein | +Inquiry |
GTPBP2-4471H | Recombinant Human GTPBP2 Protein, GST-tagged | +Inquiry |
GTPBP2-13607H | Recombinant Human GTPBP2, His-tagged | +Inquiry |
GTPBP2-2015R | Recombinant Rhesus monkey GTPBP2 Protein, His-tagged | +Inquiry |
GTPBP2-4220Z | Recombinant Zebrafish GTPBP2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTPBP2-766HCL | Recombinant Human GTPBP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GTPBP2 Products
Required fields are marked with *
My Review for All GTPBP2 Products
Required fields are marked with *
0
Inquiry Basket