Recombinant Human GTSF1 protein, GST-tagged
Cat.No. : | GTSF1-1802H |
Product Overview : | Recombinant Human GTSF1 protein(1-167 aa), fused to GST tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-167 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MEETYTDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVASKLATCPFNARHQVPRAEISHHISSCDDRSCIEQDVVNQTRSLRQETLAESTWQCPPCDEDWDKDLWEQTSTPFAWGTTHYSDNNSPASNIVTEHKNNLASGMRVPKSLPYVLPWKNNGNAQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GTSF1 gametocyte specific factor 1 [ Homo sapiens ] |
Official Symbol | GTSF1 |
Synonyms | GTSF1; gametocyte specific factor 1; FAM112B, family with sequence similarity 112, member B; gametocyte-specific factor 1; FLJ32942; family with sequence similarity 112, member B; FAM112B; |
Gene ID | 121355 |
mRNA Refseq | NM_144594 |
Protein Refseq | NP_653195 |
UniProt ID | Q8WW33 |
◆ Recombinant Proteins | ||
GTSF1-4005M | Recombinant Mouse GTSF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GTSF1-7381M | Recombinant Mouse GTSF1 Protein | +Inquiry |
GTSF1-1802H | Recombinant Human GTSF1 protein, GST-tagged | +Inquiry |
Gtsf1-3336M | Recombinant Mouse Gtsf1 Protein, Myc/DDK-tagged | +Inquiry |
GTSF1-583C | Recombinant Cynomolgus GTSF1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTSF1-5679HCL | Recombinant Human GTSF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GTSF1 Products
Required fields are marked with *
My Review for All GTSF1 Products
Required fields are marked with *
0
Inquiry Basket