Recombinant Human GYPA Protein (20-91 aa), His-tagged

Cat.No. : GYPA-1408H
Product Overview : Recombinant Human GYPA Protein (20-91 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 20-91 aa
Description : Glycophorin A is the major intrinsic mbrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte mbrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma mbrane. Is a receptor for influenza virus. Is a receptor for Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans. Appears to be a receptor for Hepatitis A virus (HAV).
Form : Tris-based buffer,50% glycerol
Molecular Mass : 9.9 kDa
AA Sequence : LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name GYPA glycophorin A (MNS blood group) [ Homo sapiens ]
Official Symbol GYPA
Synonyms GYPA; CD235a; GPA; MN; MNS; GPSAT; PAS-2; GPErik; HGpMiV; HGpMiXI; HGpSta(C);
Gene ID 2993
mRNA Refseq NM_002099
Protein Refseq NP_002090
UniProt ID A0A0C4DFT7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GYPA Products

Required fields are marked with *

My Review for All GYPA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon