Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human GZMA

Cat.No. : GZMA-26406TH
Product Overview : Recombinant fragment of Human Granzyme A (aa 41-141) with N-terminal proprietary tag, 36.74 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.
Protein length : 101 amino acids
Molecular Weight : 36.740kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVIL GAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQL TEKAKINKYVTILHLPKKGDD
Sequence Similarities : Belongs to the peptidase S1 family. Granzyme subfamily.Contains 1 peptidase S1 domain.
Gene Name : GZMA granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) [ Homo sapiens ]
Official Symbol : GZMA
Synonyms : GZMA; granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); CTLA3, HFSP; granzyme A; CTL tryptase; Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease);
Gene ID : 3001
mRNA Refseq : NM_006144
Protein Refseq : NP_006135
MIM : 140050
Uniprot ID : P12544
Chromosome Location : 5q11-q12
Pathway : IL12-mediated signaling events, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem;
Function : peptidase activity; protein binding; protein homodimerization activity; serine-type endopeptidase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends