Recombinant Human GZMA

Cat.No. : GZMA-26406TH
Product Overview : Recombinant fragment of Human Granzyme A (aa 41-141) with N-terminal proprietary tag, 36.74 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 101 amino acids
Description : Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells.
Molecular Weight : 36.740kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVIL GAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQL TEKAKINKYVTILHLPKKGDD
Sequence Similarities : Belongs to the peptidase S1 family. Granzyme subfamily.Contains 1 peptidase S1 domain.
Gene Name GZMA granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) [ Homo sapiens ]
Official Symbol GZMA
Synonyms GZMA; granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); CTLA3, HFSP; granzyme A; CTL tryptase; Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease);
Gene ID 3001
mRNA Refseq NM_006144
Protein Refseq NP_006135
MIM 140050
Uniprot ID P12544
Chromosome Location 5q11-q12
Pathway IL12-mediated signaling events, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; Neuroactive ligand-receptor interaction, conserved biosystem;
Function peptidase activity; protein binding; protein homodimerization activity; serine-type endopeptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GZMA Products

Required fields are marked with *

My Review for All GZMA Products

Required fields are marked with *

0
cart-icon
0
compare icon