Recombinant Full Length Human GZMA Protein, GST-tagged

Cat.No. : GZMA-3386HF
Product Overview : Human GZMA full-length ORF ( NP_006135.1, 1 a.a. - 262 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 262 amino acids
Description : Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface nonself antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. [provided by RefSeq
Molecular Mass : 55.4 kDa
AA Sequence : MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GZMA granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) [ Homo sapiens ]
Official Symbol GZMA
Synonyms GZMA; granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); CTLA3, HFSP; granzyme A; CTL tryptase; Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease); HF; h factor; fragmentin-1; cytotoxic T-lymphocyte proteinase 1; Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease); HFSP; CTLA3;
Gene ID 3001
mRNA Refseq NM_006144
Protein Refseq NP_006135
MIM 140050
UniProt ID P12544

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GZMA Products

Required fields are marked with *

My Review for All GZMA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon