Recombinant Human HACE1 Protein, GST-tagged
| Cat.No. : | HACE1-4552H |
| Product Overview : | Human HACE1 partial ORF ( NP_065822, 800 a.a. - 909 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a HECT domain and ankyrin repeat-containing ubiquitin ligase. The encoded protein is involved in specific tagging of target proteins, leading to their subcellular localization or proteasomal degradation. The protein is a potential tumor suppressor and is involved in the pathophysiology of several tumors, including Wilm's tumor. [provided by RefSeq, Mar 2016] |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | TEYTSGYEREDPVIQWFWEVVEDITQEERVLLLQFVTGSSRVPHGGFANIMGGSGLQNFTIAAVPYTPNLLPTSSTCINMLKLPEYPSKEILKDRLLVALHCGSYGYTMA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HACE1 HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1 [ Homo sapiens ] |
| Official Symbol | HACE1 |
| Synonyms | HACE1; HECT domain and ankyrin repeat containing E3 ubiquitin protein ligase 1; E3 ubiquitin-protein ligase HACE1; KIAA1320; HECT domain and ankyrin repeat-containing E3 ubiquitin-protein ligase 1; HECT domain and ankyrin repeat containing, E3 ubiquitin protein ligase 1; |
| Gene ID | 57531 |
| mRNA Refseq | NM_020771 |
| Protein Refseq | NP_065822 |
| MIM | 610876 |
| UniProt ID | Q8IYU2 |
| ◆ Recombinant Proteins | ||
| HACE1-4552H | Recombinant Human HACE1 Protein, GST-tagged | +Inquiry |
| HACE1-0421H | Recombinant Human HACE1 Protein (E2-A909), His tagged | +Inquiry |
| HACE1-5404C | Recombinant Chicken HACE1 | +Inquiry |
| HACE1-4049M | Recombinant Mouse HACE1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Hace1-3350M | Recombinant Mouse Hace1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HACE1-5648HCL | Recombinant Human HACE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HACE1 Products
Required fields are marked with *
My Review for All HACE1 Products
Required fields are marked with *
