Recombinant Human HADHB Protein (35-283 aa), GST-tagged

• Cat.No.: HADHB-1193H
• Product Overview: Recombinant Human HADHB Protein (35-283 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 35-283 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 53.8 kDa
• AA Sequence: APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: HADHB hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit [ Homo sapiens ]
• Official Symbol: HADHB
• Synonyms: HADHB; ECHB; MSTP029; TP-BETA; MGC87480
• Gene ID: 3032
• mRNA Refseq: NM_000183
• Protein Refseq: NP_000174
• MIM: 143450
• UniProt ID: P55084