Recombinant Human HADHB Protein (35-283 aa), GST-tagged
| Cat.No. : | HADHB-1193H |
| Product Overview : | Recombinant Human HADHB Protein (35-283 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 35-283 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 53.8 kDa |
| AA Sequence : | APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | HADHB hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit [ Homo sapiens ] |
| Official Symbol | HADHB |
| Synonyms | HADHB; ECHB; MSTP029; TP-BETA; MGC87480; |
| Gene ID | 3032 |
| mRNA Refseq | NM_000183 |
| Protein Refseq | NP_000174 |
| MIM | 143450 |
| UniProt ID | P55084 |
| ◆ Recombinant Proteins | ||
| HADHB-7469M | Recombinant Mouse HADHB Protein | +Inquiry |
| HADHB-3445HF | Recombinant Full Length Human HADHB Protein, GST-tagged | +Inquiry |
| Hadhb-4762M | Recombinant Mouse Hadhb protein, His&Myc-tagged | +Inquiry |
| HADHB-10378Z | Recombinant Zebrafish HADHB | +Inquiry |
| HADHB-1193H | Recombinant Human HADHB Protein (35-283 aa), GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HADHB-5645HCL | Recombinant Human HADHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HADHB Products
Required fields are marked with *
My Review for All HADHB Products
Required fields are marked with *
