Recombinant Human HADHB Protein (35-283 aa), GST-tagged
Cat.No. : | HADHB-1193H |
Product Overview : | Recombinant Human HADHB Protein (35-283 aa) is produced by E. coli expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Metabolism. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 35-283 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 53.8 kDa |
AA Sequence : | APAVQTKTKKTLAKPNIRNVVVVDGVRTPFLLSGTSYKDLMPHDLARAALTGLLHRTSVPKEVVDYIIFGTVIQEVKTSNVAREAALGAGFSDKTPAHTVTMACISANQAMTTGVGLIASGQCDVIVAGGVELMSDVPIRHSRKMRKLMLDLNKAKSMGQRLSLISKFRFNFLAPELPAVSEFSTSETMGHSADRLAAAFAVSRLEQDEYALRSHSLAKKAQDEGLLSDVVPFKVPGKDTVTKDNGIRP |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | HADHB hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), beta subunit [ Homo sapiens ] |
Official Symbol | HADHB |
Synonyms | HADHB; ECHB; MSTP029; TP-BETA; MGC87480; |
Gene ID | 3032 |
mRNA Refseq | NM_000183 |
Protein Refseq | NP_000174 |
MIM | 143450 |
UniProt ID | P55084 |
◆ Recombinant Proteins | ||
HADHB-10378Z | Recombinant Zebrafish HADHB | +Inquiry |
Hadhb-1715M | Recombinant Mouse Hadhb protein, His & T7-tagged | +Inquiry |
HADHB-7469M | Recombinant Mouse HADHB Protein | +Inquiry |
HADHB-3445HF | Recombinant Full Length Human HADHB Protein, GST-tagged | +Inquiry |
HADHB-1193H | Recombinant Human HADHB Protein (35-283 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HADHB-5645HCL | Recombinant Human HADHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HADHB Products
Required fields are marked with *
My Review for All HADHB Products
Required fields are marked with *
0
Inquiry Basket