Recombinant Human HAPLN1 protein, His-tagged
| Cat.No. : | HAPLN1-6744H |
| Product Overview : | Recombinant Human HAPLN1 protein(16-131 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 16-131 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HAPLN1 hyaluronan and proteoglycan link protein 1 [ Homo sapiens ] |
| Official Symbol | HAPLN1 |
| Synonyms | HAPLN1; hyaluronan and proteoglycan link protein 1; cartilage linking protein 1 , CRTL1; Cartilage link protein; cartilage-link protein; proteoglycan link protein; cartilage linking protein 1; cartilage-linking protein 1; CRTL1; |
| Gene ID | 1404 |
| mRNA Refseq | NM_001884 |
| Protein Refseq | NP_001875 |
| MIM | 115435 |
| UniProt ID | P10915 |
| ◆ Recombinant Proteins | ||
| HAPLN1-4574H | Recombinant Human HAPLN1 Protein, GST-tagged | +Inquiry |
| HAPLN1-574H | Recombinant Human HAPLN1 protein | +Inquiry |
| Hapln1-5023M | Recombinant Mouse Hapln1 protein, His-tagged | +Inquiry |
| HAPLN1-750H | Recombinant Human HAPLN1 protein, His-tagged | +Inquiry |
| HAPLN1-1819M | Recombinant Mouse HAPLN1 Protein (10-356 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAPLN1-2942HCL | Recombinant Human HAPLN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN1 Products
Required fields are marked with *
My Review for All HAPLN1 Products
Required fields are marked with *
