Recombinant Human HAPLN4 Protein, GST-tagged
| Cat.No. : | HAPLN4-4578H |
| Product Overview : | Human HAPLN4 partial ORF ( NP_075378, 30 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HAPLN4 (Hyaluronan And Proteoglycan Link Protein 4) is a Protein Coding gene. Among its related pathways are Phospholipase-C Pathway and ERK Signaling. GO annotations related to this gene include extracellular matrix structural constituent and hyaluronic acid binding. An important paralog of this gene is HAPLN1. |
| Molecular Mass : | 37.29 kDa |
| AA Sequence : | QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HAPLN4 hyaluronan and proteoglycan link protein 4 [ Homo sapiens ] |
| Official Symbol | HAPLN4 |
| Synonyms | HAPLN4; hyaluronan and proteoglycan link protein 4; BRAL2; KIAA1926; brain link protein 2; |
| Gene ID | 404037 |
| mRNA Refseq | NM_023002 |
| Protein Refseq | NP_075378 |
| UniProt ID | Q86UW8 |
| ◆ Recombinant Proteins | ||
| HAPLN4-4578H | Recombinant Human HAPLN4 Protein, GST-tagged | +Inquiry |
| HAPLN4-13668H | Recombinant Human HAPLN4 protein, GST-tagged | +Inquiry |
| HAPLN4-30131H | Recombinant Human HAPLN4 protein, GST-tagged | +Inquiry |
| HAPLN4-4012Z | Recombinant Zebrafish HAPLN4 | +Inquiry |
| HAPLN4-3017H | Recombinant Human HAPLN4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAPLN4 Products
Required fields are marked with *
My Review for All HAPLN4 Products
Required fields are marked with *
