Recombinant Human HAPLN4 Protein, GST-tagged

Cat.No. : HAPLN4-4578H
Product Overview : Human HAPLN4 partial ORF ( NP_075378, 30 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HAPLN4 (Hyaluronan And Proteoglycan Link Protein 4) is a Protein Coding gene. Among its related pathways are Phospholipase-C Pathway and ERK Signaling. GO annotations related to this gene include extracellular matrix structural constituent and hyaluronic acid binding. An important paralog of this gene is HAPLN1.
Molecular Mass : 37.29 kDa
AA Sequence : QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HAPLN4 hyaluronan and proteoglycan link protein 4 [ Homo sapiens ]
Official Symbol HAPLN4
Synonyms HAPLN4; hyaluronan and proteoglycan link protein 4; BRAL2; KIAA1926; brain link protein 2;
Gene ID 404037
mRNA Refseq NM_023002
Protein Refseq NP_075378
UniProt ID Q86UW8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HAPLN4 Products

Required fields are marked with *

My Review for All HAPLN4 Products

Required fields are marked with *

0
cart-icon