Recombinant Human HAPLN4 Protein, GST-tagged
Cat.No. : | HAPLN4-4578H |
Product Overview : | Human HAPLN4 partial ORF ( NP_075378, 30 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HAPLN4 (Hyaluronan And Proteoglycan Link Protein 4) is a Protein Coding gene. Among its related pathways are Phospholipase-C Pathway and ERK Signaling. GO annotations related to this gene include extracellular matrix structural constituent and hyaluronic acid binding. An important paralog of this gene is HAPLN1. |
Molecular Mass : | 37.29 kDa |
AA Sequence : | QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HAPLN4 hyaluronan and proteoglycan link protein 4 [ Homo sapiens ] |
Official Symbol | HAPLN4 |
Synonyms | HAPLN4; hyaluronan and proteoglycan link protein 4; BRAL2; KIAA1926; brain link protein 2; |
Gene ID | 404037 |
mRNA Refseq | NM_023002 |
Protein Refseq | NP_075378 |
UniProt ID | Q86UW8 |
◆ Recombinant Proteins | ||
HAPLN4-748H | Recombinant Human HAPLN4 protein, His-tagged | +Inquiry |
HAPLN4-3017H | Recombinant Human HAPLN4 protein, His-tagged | +Inquiry |
HAPLN4-30131H | Recombinant Human HAPLN4 protein, GST-tagged | +Inquiry |
HAPLN4-13668H | Recombinant Human HAPLN4 protein, GST-tagged | +Inquiry |
HAPLN4-4057M | Recombinant Mouse HAPLN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAPLN4 Products
Required fields are marked with *
My Review for All HAPLN4 Products
Required fields are marked with *
0
Inquiry Basket