Recombinant Human HBD protein, His-GST-tagged

Cat.No. : HBD-4296H
Product Overview : Recombinant Human HBD protein(P02042)(2-147aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST&His
Protein Length : 2-147aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 47.5 kDa
AA Sequence : VHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name HBD hemoglobin, delta [ Homo sapiens ]
Official Symbol HBD
Synonyms hemoglobin, delta; 4829; Ensembl:ENSG00000223609; hemoglobin subunit delta;delta globin;delta-globin chain;hemoglobin delta chain;
Gene ID 3045
mRNA Refseq NM_000519.3
Protein Refseq NP_000510.1
MIM 142000
UniProt ID A0N071

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBD Products

Required fields are marked with *

My Review for All HBD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon