Recombinant Human HBD protein, His-GST-tagged

• Cat.No.: HBD-4296H
• Product Overview: Recombinant Human HBD protein(P02042)(2-147aa), fused to N-terminal His tag and GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST&His
• Protein Length: 2-147aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 47.5 kDa
• AA Sequence: VHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: HBD hemoglobin, delta [ Homo sapiens ]
• Official Symbol: HBD
• Synonyms: hemoglobin, delta; 4829; Ensembl:ENSG00000223609; hemoglobin subunit delta;delta globin;delta-globin chain;hemoglobin delta chain
• Gene ID: 3045
• mRNA Refseq: NM_000519.3
• Protein Refseq: NP_000510.1
• MIM: 142000
• UniProt ID: A0N071