Recombinant Human HBD protein, His-GST-tagged
Cat.No. : | HBD-4296H |
Product Overview : | Recombinant Human HBD protein(P02042)(2-147aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 2-147aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.5 kDa |
AA Sequence : | VHLTPEEKTAVNALWGKVNVDAVGGEALGRLLVVYPWTQRFFESFGDLSSPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFSQLSELHCDKLHVDPENFRLLGNVLVCVLARNFGKEFTPQMQAAYQKVVAGVANALAHKYH |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | HBD hemoglobin, delta [ Homo sapiens ] |
Official Symbol | HBD |
Synonyms | hemoglobin, delta; 4829; Ensembl:ENSG00000223609; hemoglobin subunit delta;delta globin;delta-globin chain;hemoglobin delta chain; |
Gene ID | 3045 |
mRNA Refseq | NM_000519.3 |
Protein Refseq | NP_000510.1 |
MIM | 142000 |
UniProt ID | A0N071 |
◆ Recombinant Proteins | ||
HBD-4296H | Recombinant Human HBD protein, His-GST-tagged | +Inquiry |
HBD-1060H | Recombinant Human HBD Protein, His-tagged | +Inquiry |
HBD-13680H | Recombinant Human HBD, GST-tagged | +Inquiry |
HBD-2443H | Recombinant Human HBD Protein (Met1-Ala143), N-GST tagged | +Inquiry |
HBD-7861H | Recombinant Human HBD protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HBD-5621HCL | Recombinant Human HBD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBD Products
Required fields are marked with *
My Review for All HBD Products
Required fields are marked with *