Recombinant Human HBXIP Protein, GST-tagged
| Cat.No. : | HBXIP-4611H |
| Product Overview : | Human HBXIP full-length ORF ( AAH62619, 83 a.a. - 173 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a protein that specifically complexes with the C-terminus of hepatitis B virus X protein (HBx). The function of this protein is to negatively regulate HBx activity and thus to alter the replication life cycle of the virus. [provided by RefSeq |
| Molecular Mass : | 35.75 kDa |
| AA Sequence : | MEATLEQHLEDTMKNPSIVGVLCTDSQGLNLGCRGTLSDEHAGVISVLAQQAAKLTSDPTDIPVVCLESDNGNIMIQKHDGITVAAHKMAS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HBXIP hepatitis B virus x interacting protein [ Homo sapiens ] |
| Official Symbol | HBXIP |
| Synonyms | HBXIP; hepatitis B virus x interacting protein; hepatitis B virus X-interacting protein; HBx interacting protein; hepatitis B virus x interacting protein (9.6kD); MGC71071; XIP; HBx-interacting protein; HBV X-interacting protein; hepatitis B virus x-interacting protein (9.6kD); |
| Gene ID | 10542 |
| mRNA Refseq | NM_006402 |
| Protein Refseq | NP_006393 |
| MIM | 608521 |
| UniProt ID | O43504 |
| ◆ Recombinant Proteins | ||
| HBXIP-13689H | Recombinant Human HBXIP protein, GST-tagged | +Inquiry |
| HBXIP-4063C | Recombinant Chicken HBXIP | +Inquiry |
| HBXIP-6961H | Recombinant Human Hepatitis B Virus X Interacting Protein, His-tagged | +Inquiry |
| HBXIP-4611H | Recombinant Human HBXIP Protein, GST-tagged | +Inquiry |
| HBXIP-3501HF | Recombinant Full Length Human HBXIP Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HBXIP-5616HCL | Recombinant Human HBXIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBXIP Products
Required fields are marked with *
My Review for All HBXIP Products
Required fields are marked with *



