Recombinant Human HBZ Protein, GST-tagged

Cat.No. : HBZ-4612H
Product Overview : Human HBZ full-length ORF ( AAH27892, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5 - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3. [provided by RefSeq
Molecular Mass : 41.36 kDa
AA Sequence : MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HBZ hemoglobin, zeta [ Homo sapiens ]
Official Symbol HBZ
Synonyms HBZ; hemoglobin, zeta; hemoglobin subunit zeta; HBAZ; zeta-globin; hemoglobin zeta chain;
Gene ID 3050
mRNA Refseq NM_005332
Protein Refseq NP_005323
MIM 142310
UniProt ID P02008

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBZ Products

Required fields are marked with *

My Review for All HBZ Products

Required fields are marked with *

0
cart-icon