Recombinant Human HBZ protein, GST-tagged
| Cat.No. : | HBZ-3023H |
| Product Overview : | Recombinant Human HBZ protein(P02008)(1-142aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-142aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 42.5 kDa |
| AA Sequence : | SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | HBZ hemoglobin, zeta [ Homo sapiens ] |
| Official Symbol | HBZ |
| Synonyms | HBZ; hemoglobin, zeta; hemoglobin subunit zeta; HBAZ; zeta-globin; hemoglobin zeta chain; |
| Gene ID | 3050 |
| mRNA Refseq | NM_005332 |
| Protein Refseq | NP_005323 |
| MIM | 142310 |
| UniProt ID | P02008 |
| ◆ Recombinant Proteins | ||
| HBZ-4892HF | Recombinant Human HBZ protein, C-Myc/DDK tagged | +Inquiry |
| HBZ-29185TH | Recombinant Human HBZ, His-tagged | +Inquiry |
| HBZ-4612H | Recombinant Human HBZ Protein, GST-tagged | +Inquiry |
| HBZ-3352H | Recombinant Human HBZ Protein (Met1-Arg142), N-His tagged | +Inquiry |
| HBZ-3023H | Recombinant Human HBZ protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HBZ-5615HCL | Recombinant Human HBZ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HBZ Products
Required fields are marked with *
My Review for All HBZ Products
Required fields are marked with *
