Recombinant Human HCAR1 Protein, GST-tagged

• Cat.No.: HCAR1-5268H
• Product Overview: Human GPR81 partial ORF (NP_115943.1, 247 a.a. - 346 a.a.) recombinant protein with GST tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 247-346 a.a.
• Description: G protein-coupled receptors (GPCRs, or GPRs), such as GPR81, contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM
• Molecular Mass: 36.63 kDa
• AA Sequence: VPSSACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HCAR1 hydroxycarboxylic acid receptor 1 [ Homo sapiens (human) ]
• Official Symbol: HCAR1
• Synonyms: HCAR1; hydroxycarboxylic acid receptor 1; HCA1; GPR81; LACR1; FKSG80; GPR104; TAGPCR; TA-GPCR; hydroxycarboxylic acid receptor 1; G protein-coupled receptor 104; G-protein coupled receptor 81; T-cell activation G protein-coupled receptor; hydroxy-carboxylic acid receptor 1; lactate receptor 1
• Gene ID: 27198
• mRNA Refseq: NM_032554
• Protein Refseq: NP_115943
• MIM: 606923
• UniProt ID: Q9BXC0