Recombinant Human HCAR1 Protein, GST-tagged
| Cat.No. : | HCAR1-5268H |
| Product Overview : | Human GPR81 partial ORF (NP_115943.1, 247 a.a. - 346 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 247-346 a.a. |
| Description : | G protein-coupled receptors (GPCRs, or GPRs), such as GPR81, contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | VPSSACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HCAR1 hydroxycarboxylic acid receptor 1 [ Homo sapiens (human) ] |
| Official Symbol | HCAR1 |
| Synonyms | HCAR1; hydroxycarboxylic acid receptor 1; HCA1; GPR81; LACR1; FKSG80; GPR104; TAGPCR; TA-GPCR; hydroxycarboxylic acid receptor 1; G protein-coupled receptor 104; G-protein coupled receptor 81; T-cell activation G protein-coupled receptor; hydroxy-carboxylic acid receptor 1; lactate receptor 1 |
| Gene ID | 27198 |
| mRNA Refseq | NM_032554 |
| Protein Refseq | NP_115943 |
| MIM | 606923 |
| UniProt ID | Q9BXC0 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCAR1 Products
Required fields are marked with *
My Review for All HCAR1 Products
Required fields are marked with *



