Recombinant Human HCAR1 Protein, GST-tagged

Cat.No. : HCAR1-5268H
Product Overview : Human GPR81 partial ORF (NP_115943.1, 247 a.a. - 346 a.a.) recombinant protein with GST tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 247-346 a.a.
Description : G protein-coupled receptors (GPCRs, or GPRs), such as GPR81, contain 7 transmembrane domains and transduce extracellular signals through heterotrimeric G proteins.[supplied by OMIM
Molecular Mass : 36.63 kDa
AA Sequence : VPSSACDPSVHGALHITLSFTYMNSMLDPLVYYFSSPSFPKFYNKLKICSLKPKQPGHSKTQRPEEMPISNLGRRSCISVANSFQSQSDGQWDPHIVEWH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HCAR1 hydroxycarboxylic acid receptor 1 [ Homo sapiens (human) ]
Official Symbol HCAR1
Synonyms HCAR1; hydroxycarboxylic acid receptor 1; HCA1; GPR81; LACR1; FKSG80; GPR104; TAGPCR; TA-GPCR; hydroxycarboxylic acid receptor 1; G protein-coupled receptor 104; G-protein coupled receptor 81; T-cell activation G protein-coupled receptor; hydroxy-carboxylic acid receptor 1; lactate receptor 1
Gene ID 27198
mRNA Refseq NM_032554
Protein Refseq NP_115943
MIM 606923
UniProt ID Q9BXC0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HCAR1 Products

Required fields are marked with *

My Review for All HCAR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon