Recombinant Human HCN4 protein, His-tagged
| Cat.No. : | HCN4-3477H |
| Product Overview : | Recombinant Human HCN4 protein(1-213 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | August 26, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-213 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AASequence : | MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDAEEEGAGGRQDPSRRSIRLRPLPSPSPSAAAGGTESRSSALGAADSEGPARGAGKSSTNGDCRRFRGSLASLGSRGGGSGGTGSGSSHGHLHDSAEERRLIAEGDASPGEDRTPPGLAAEPERPGASAQPAASPPPPQQPPQPASASCEQPSVDTAIKVEGGAAAGDQILPEAEVRLGQAGF |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | HCN4 hyperpolarization activated cyclic nucleotide-gated potassium channel 4 [ Homo sapiens ] |
| Official Symbol | HCN4 |
| Synonyms | HCN4; hyperpolarization activated cyclic nucleotide-gated potassium channel 4; potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4; hyperpolarization activated cyclic nucleotide-gated cation channel 4; SSS2; |
| Gene ID | 10021 |
| mRNA Refseq | NM_005477 |
| Protein Refseq | NP_005468 |
| MIM | 605206 |
| UniProt ID | Q9Y3Q4 |
| ◆ Recombinant Proteins | ||
| HCN4-1183HFL | Recombinant Human HCN4 protein, His&Flag-tagged | +Inquiry |
| HCN4-3477H | Recombinant Human HCN4 protein, His-tagged | +Inquiry |
| HCN4-2809R | Recombinant Rat HCN4 Protein | +Inquiry |
| HCN4-4630H | Recombinant Human HCN4 Protein, GST-tagged | +Inquiry |
| HCN4-2464R | Recombinant Rat HCN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCN4 Products
Required fields are marked with *
My Review for All HCN4 Products
Required fields are marked with *


