Recombinant Human HCN4 Protein, GST-tagged

Cat.No. : HCN4-4630H
Product Overview : Human HCN4 partial ORF ( NP_005468.1, 1105 a.a. - 1203 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the hyperpolarization-activated cyclic nucleotide-gated potassium channels. The encoded protein shows slow kinetics of activation and inactivation, and is necessary for the cardiac pacemaking process. This channel may also mediate responses to sour stimuli. Mutations in this gene have been linked to sick sinus syndrome 2, also known as atrial fibrillation with bradyarrhythmia or familial sinus bradycardia. Two pseudogenes have been identified on chromosome 15. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : SPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGRPYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLPSNL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HCN4 hyperpolarization activated cyclic nucleotide-gated potassium channel 4 [ Homo sapiens ]
Official Symbol HCN4
Synonyms HCN4; hyperpolarization activated cyclic nucleotide-gated potassium channel 4; potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4; hyperpolarization activated cyclic nucleotide-gated cation channel 4; SSS2;
Gene ID 10021
mRNA Refseq NM_005477
Protein Refseq NP_005468
MIM 605206
UniProt ID Q9Y3Q4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HCN4 Products

Required fields are marked with *

My Review for All HCN4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon