Recombinant Human HCN4 Protein, GST-tagged
| Cat.No. : | HCN4-4630H |
| Product Overview : | Human HCN4 partial ORF ( NP_005468.1, 1105 a.a. - 1203 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the hyperpolarization-activated cyclic nucleotide-gated potassium channels. The encoded protein shows slow kinetics of activation and inactivation, and is necessary for the cardiac pacemaking process. This channel may also mediate responses to sour stimuli. Mutations in this gene have been linked to sick sinus syndrome 2, also known as atrial fibrillation with bradyarrhythmia or familial sinus bradycardia. Two pseudogenes have been identified on chromosome 15. [provided by RefSeq |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | SPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGRPYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLPSNL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HCN4 hyperpolarization activated cyclic nucleotide-gated potassium channel 4 [ Homo sapiens ] |
| Official Symbol | HCN4 |
| Synonyms | HCN4; hyperpolarization activated cyclic nucleotide-gated potassium channel 4; potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4; hyperpolarization activated cyclic nucleotide-gated cation channel 4; SSS2; |
| Gene ID | 10021 |
| mRNA Refseq | NM_005477 |
| Protein Refseq | NP_005468 |
| MIM | 605206 |
| UniProt ID | Q9Y3Q4 |
| ◆ Recombinant Proteins | ||
| HCN4-2809R | Recombinant Rat HCN4 Protein | +Inquiry |
| HCN4-4630H | Recombinant Human HCN4 Protein, GST-tagged | +Inquiry |
| HCN4-3477H | Recombinant Human HCN4 protein, His-tagged | +Inquiry |
| HCN4-1183HFL | Recombinant Human HCN4 protein, His&Flag-tagged | +Inquiry |
| HCN4-2464R | Recombinant Rat HCN4 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCN4 Products
Required fields are marked with *
My Review for All HCN4 Products
Required fields are marked with *
