Recombinant Human HCRTR1 Protein

• Cat.No.: HCRTR1-4633H
• Product Overview: Human HCRTR1 full-length ORF (AAH74796.1) recombinant protein without tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Description: The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein selectively binds the hypothalamic neuropeptide orexin A. A related gene (HCRTR2) encodes a G-protein coupled receptor that binds orexin A and orexin B. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 47.5 kDa
• AA Sequence: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWVLIAAYVAVFVVALVGNTLVCLAVWRNHHMRTVTNYFIVNLSLADVLVTAICLPASLLVDITESWLFGHALCKVIPYLQAVSVSVAVLTLSFIALDRWYAICHPLLFKSTARRARGSILGIWAVSLAIMVPQAAVMECSSVLPELANRTRLFSVCDERWADDLYPKIYHSCFFIVTYLAPLGLMAMAYFQIFRKLWGRQIPGTTSALVRNWKRPSDQLGDLEQGLSGEPQPRARAFLAEVKQMRARRKTAKMLMVVLLVFALCYLPISVLNVLKRVFGMFRQASDREAVYACFTFSHWLVYANSAANPIIYNFLSGKFREQFKAAFSCCLPGLGPCGSLKAPSPRSSASHKSLSLQSRCSISKISEHVVLTSVTTVLP
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Usage: Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: HCRTR1 hypocretin (orexin) receptor 1 [ Homo sapiens ]
• Official Symbol: HCRTR1
• Synonyms: HCRTR1; hypocretin (orexin) receptor 1; orexin receptor type 1; OX1R; ox1-R; ox-1-R; orexin receptor 1; orexin receptor-1; hypocretin receptor 1; hypocretin receptor-1; hypocretin receptor type 1
• Gene ID: 3061
• mRNA Refseq: NM_001525
• Protein Refseq: NP_001516
• MIM: 602392
• UniProt ID: O43613