Recombinant Human HCRTR2 Protein, GST-tagged
Cat.No. : | HCRTR2-4636H |
Product Overview : | Human HCRTR2 partial ORF ( NP_001517, 1 a.a. - 54 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein binds the hypothalamic neuropeptides orexin A and orexin B. A related gene (HCRTR1) encodes a G-protein coupled receptor that selectively binds orexin A. [provided by RefSeq |
Molecular Mass : | 31.68 kDa |
AA Sequence : | MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HCRTR2 hypocretin (orexin) receptor 2 [ Homo sapiens ] |
Official Symbol | HCRTR2 |
Synonyms | HCRTR2; hypocretin (orexin) receptor 2; orexin receptor type 2; OX2R; ox2-R; ox-2-R; hypocretin receptor type 2; |
Gene ID | 3062 |
mRNA Refseq | NM_001526 |
Protein Refseq | NP_001517 |
MIM | 602393 |
UniProt ID | O43614 |
◆ Recombinant Proteins | ||
HCRTR2-4636H | Recombinant Human HCRTR2 Protein, GST-tagged | +Inquiry |
HCRTR2-2188C | Recombinant Chicken HCRTR2 | +Inquiry |
HCRTR2-7524M | Recombinant Mouse HCRTR2 Protein | +Inquiry |
HCRTR2-2812R | Recombinant Rat HCRTR2 Protein | +Inquiry |
HCRTR2-2467R | Recombinant Rat HCRTR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCRTR2-775HCL | Recombinant Human HCRTR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCRTR2 Products
Required fields are marked with *
My Review for All HCRTR2 Products
Required fields are marked with *
0
Inquiry Basket