Recombinant Human HCRTR2 Protein, GST-tagged

Cat.No. : HCRTR2-4636H
Product Overview : Human HCRTR2 partial ORF ( NP_001517, 1 a.a. - 54 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein binds the hypothalamic neuropeptides orexin A and orexin B. A related gene (HCRTR1) encodes a G-protein coupled receptor that selectively binds orexin A. [provided by RefSeq
Molecular Mass : 31.68 kDa
AA Sequence : MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HCRTR2 hypocretin (orexin) receptor 2 [ Homo sapiens ]
Official Symbol HCRTR2
Synonyms HCRTR2; hypocretin (orexin) receptor 2; orexin receptor type 2; OX2R; ox2-R; ox-2-R; hypocretin receptor type 2;
Gene ID 3062
mRNA Refseq NM_001526
Protein Refseq NP_001517
MIM 602393
UniProt ID O43614

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HCRTR2 Products

Required fields are marked with *

My Review for All HCRTR2 Products

Required fields are marked with *

0
cart-icon