Recombinant Human HCRTR2 protein, hFc1-tagged
Cat.No. : | HCRTR2-4620H |
Product Overview : | Recombinant Human HCRTR2 protein(O43614)(1-54 aa), fused with C-terminal hFc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Fc |
Protein Length : | 1-54 aa |
Form : | For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process. |
Molecular Mass : | 32.5 kDa |
AASequence : | MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C. |
Gene Name | HCRTR2 hypocretin (orexin) receptor 2 [ Homo sapiens ] |
Official Symbol | HCRTR2 |
Synonyms | HCRTR2; hypocretin (orexin) receptor 2; orexin receptor type 2; OX2R; ox2-R; ox-2-R; hypocretin receptor type 2; |
Gene ID | 3062 |
mRNA Refseq | NM_001526 |
Protein Refseq | NP_001517 |
MIM | 602393 |
UniProt ID | O43614 |
◆ Recombinant Proteins | ||
HCRTR2-7524M | Recombinant Mouse HCRTR2 Protein | +Inquiry |
RFL9872MF | Recombinant Full Length Mouse Orexin Receptor Type 2(Hcrtr2) Protein, His-Tagged | +Inquiry |
HCRTR2-4086M | Recombinant Mouse HCRTR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HCRTR2-5424H | Recombinant Human HCRTR2 protein, His-tagged | +Inquiry |
HCRTR2-2467R | Recombinant Rat HCRTR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HCRTR2-775HCL | Recombinant Human HCRTR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HCRTR2 Products
Required fields are marked with *
My Review for All HCRTR2 Products
Required fields are marked with *