Recombinant Human HCRTR2 protein, hFc1-tagged

• Cat.No.: HCRTR2-4620H
• Product Overview: Recombinant Human HCRTR2 protein(O43614)(1-54 aa), fused with C-terminal hFc tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Fc
• Protein Length: 1-54 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 32.5 kDa
• AASequence: MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: HCRTR2 hypocretin (orexin) receptor 2 [ Homo sapiens ]
• Official Symbol: HCRTR2
• Synonyms: HCRTR2; hypocretin (orexin) receptor 2; orexin receptor type 2; OX2R; ox2-R; ox-2-R; hypocretin receptor type 2
• Gene ID: 3062
• mRNA Refseq: NM_001526
• Protein Refseq: NP_001517
• MIM: 602393
• UniProt ID: O43614