Recombinant Human HDAC2 protein, His/GST-tagged
| Cat.No. : | HDAC2-13707H |
| Product Overview : | Recombinant Human HDAC2 protein(NP_001518.3)(Met1~Pro488), fused to His and GST Tag at the N-terminus, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | Met1~Pro488 |
| Description : | This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes, and are responsible for the deacetylation of lysine residues at the N-terminal regions of core histones (H2A, H2B, H3 and H4). This protein forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus, it plays an important role in transcriptional regulation, cell cycle progression and developmental events. Alternative splicing results in multiple transcript variants. |
| Form : | 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300. |
| Molecular Mass : | 85kDa as determined by SDS-PAGE reducing conditions. |
| AA Sequence : | MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP |
| Endotoxin : | <1.0EU per 1µg (determined by the LAL method) |
| Purity : | > 90% |
| Applications : | Positive Control; Immunogen; SDS-PAGE; WB. (May be suitable for use in other assays to be determined by the end user.) |
| Notes : | The kit is designed for research use only, we will not be responsible for any issue if the kit was used in clinical diagnostic or any other procedures. |
| Stability : | The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37°C for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition. |
| Storage : | Avoid repeated freeze/thaw cycles. Store at 2-8°C for one month. Aliquot and store at -80°C for 12 months. |
| Reconstitution : | Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex. |
| Gene Name | HDAC2 histone deacetylase 2 [ Homo sapiens (human) ] |
| Official Symbol | HDAC2 |
| Synonyms | HD2; RPD3; YAF1; KDAC2 |
| Gene ID | 3066 |
| mRNA Refseq | NM_001527.4 |
| Protein Refseq | NP_001518.3 |
| MIM | 605164 |
| UniProt ID | Q92769 |
| ◆ Recombinant Proteins | ||
| HDAC2-2986H | Recombinant Human HDAC2 Protein (386-488), His tagged | +Inquiry |
| Hdac2-1621M | Recombinant Mouse Hdac2 Protein, His&GST-tagged | +Inquiry |
| HDAC2-28263TH | Active Recombinant Human HDAC2, His-tagged | +Inquiry |
| HDAC2-4090M | Recombinant Mouse HDAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HDAC2-4642H | Recombinant Human HDAC2 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HDAC2-5605HCL | Recombinant Human HDAC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC2 Products
Required fields are marked with *
My Review for All HDAC2 Products
Required fields are marked with *
