| Species : |
Human |
| Source : |
Insect Cells |
| Tag : |
His |
| Description : |
This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes and are responsible for the deacetylation of lysine residues on the N-terminal region of the core histones (H2A, H2B, H3 and H4). This protein also forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus it plays an important role in transcriptional regulation, cell cycle progression and developmental events. [provided by RefSeq |
| Form : |
Liquid |
| Molecular Mass : |
56.4 kDa |
| AA Sequence : |
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNPSRHHHHHH |
| Purity : |
> 85% by SDS-PAGE |
| Applications : |
SDS-PAGE |
| Storage : |
Store at 4 centigrade for 1-2 weeks. For long term storage store at -2 centigrade or -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Concentration : |
0.25 mg/mL |
| Storage Buffer : |
In 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM PMSF, pH 8.0 (20% glycerol, 1 mM dithiothreitol) |
