Recombinant Human HDAC2 Protein, His-tagged

Cat.No. : HDAC2-4642H
Product Overview : Human HDAC2 (NP_001518, 1 a.a. - 488 a.a.) full-length recombinant protein with His tag expressed in Hi-5 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Description : This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes and are responsible for the deacetylation of lysine residues on the N-terminal region of the core histones (H2A, H2B, H3 and H4). This protein also forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus it plays an important role in transcriptional regulation, cell cycle progression and developmental events. [provided by RefSeq
Form : Liquid
Molecular Mass : 56.4 kDa
AA Sequence : MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNPSRHHHHHH
Purity : > 85% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at 4 centigrade for 1-2 weeks. For long term storage store at -2 centigrade or -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 0.25 mg/mL
Storage Buffer : In 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM PMSF, pH 8.0 (20% glycerol, 1 mM dithiothreitol)
Gene Name HDAC2 histone deacetylase 2 [ Homo sapiens ]
Official Symbol HDAC2
Synonyms HDAC2; histone deacetylase 2; RPD3; YAF1; YY1-associated factor 1; transcriptional regulator homolog RPD3; HD2;
Gene ID 3066
mRNA Refseq NM_001527
Protein Refseq NP_001518
MIM 605164
UniProt ID Q92769

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDAC2 Products

Required fields are marked with *

My Review for All HDAC2 Products

Required fields are marked with *

0
cart-icon