Recombinant Human HDAC2 Protein, His-tagged
Cat.No. : | HDAC2-4642H |
Product Overview : | Human HDAC2 (NP_001518, 1 a.a. - 488 a.a.) full-length recombinant protein with His tag expressed in Hi-5 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Description : | This gene product belongs to the histone deacetylase family. Histone deacetylases act via the formation of large multiprotein complexes and are responsible for the deacetylation of lysine residues on the N-terminal region of the core histones (H2A, H2B, H3 and H4). This protein also forms transcriptional repressor complexes by associating with many different proteins, including YY1, a mammalian zinc-finger transcription factor. Thus it plays an important role in transcriptional regulation, cell cycle progression and developmental events. [provided by RefSeq |
Form : | Liquid |
Molecular Mass : | 56.4 kDa |
AA Sequence : | MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEEFSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNPSRHHHHHH |
Purity : | > 85% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at 4 centigrade for 1-2 weeks. For long term storage store at -2 centigrade or -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 0.25 mg/mL |
Storage Buffer : | In 20 mM Tris-HCl, 100 mM NaCl, 0.1 mM PMSF, pH 8.0 (20% glycerol, 1 mM dithiothreitol) |
Gene Name | HDAC2 histone deacetylase 2 [ Homo sapiens ] |
Official Symbol | HDAC2 |
Synonyms | HDAC2; histone deacetylase 2; RPD3; YAF1; YY1-associated factor 1; transcriptional regulator homolog RPD3; HD2; |
Gene ID | 3066 |
mRNA Refseq | NM_001527 |
Protein Refseq | NP_001518 |
MIM | 605164 |
UniProt ID | Q92769 |
◆ Recombinant Proteins | ||
Hdac2-1621M | Recombinant Mouse Hdac2 Protein, His&GST-tagged | +Inquiry |
HDAC2-3565H | Recombinant Human HDAC2, His-tagged | +Inquiry |
HDAC1-551H | Recombinant Human HDAC1 protein, His-tagged | +Inquiry |
HDAC2-4090M | Recombinant Mouse HDAC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
HDAC2-7529M | Recombinant Mouse HDAC2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDAC2-5605HCL | Recombinant Human HDAC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDAC2 Products
Required fields are marked with *
My Review for All HDAC2 Products
Required fields are marked with *
0
Inquiry Basket