Recombinant Human HDHD3 protein, His-tagged
| Cat.No. : | HDHD3-13718H |
| Product Overview : | Recombinant Human HDHD3 protein(1-251 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | January 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-251 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| AA Sequence : | MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Official Symbol | HDHD3 |
| Synonyms | HDHD3; haloacid dehalogenase-like hydrolase domain containing 3; C9orf158, chromosome 9 open reading frame 158; haloacid dehalogenase-like hydrolase domain-containing protein 3; MGC12904; C9orf158; 2810435D12Rik; |
| Gene ID | 81932 |
| mRNA Refseq | NM_031219 |
| Protein Refseq | NP_112496 |
| UniProt ID | Q9BSH5 |
| ◆ Recombinant Proteins | ||
| HDHD3-13718H | Recombinant Human HDHD3 protein, His-tagged | +Inquiry |
| Hdhd3-3375M | Recombinant Mouse Hdhd3 Protein, Myc/DDK-tagged | +Inquiry |
| HDHD3-3444HF | Recombinant Full Length Human HDHD3 Protein, GST-tagged | +Inquiry |
| HDHD3-1702H | Recombinant Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 3, His-tagged | +Inquiry |
| HDHD3-29214TH | Recombinant Human HDHD3, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HDHD3-5594HCL | Recombinant Human HDHD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDHD3 Products
Required fields are marked with *
My Review for All HDHD3 Products
Required fields are marked with *
