Recombinant Human HDHD3 Protein, GST-tagged

Cat.No. : HDHD3-4665H
Product Overview : Human HDHD3 full-length ORF ( NP_112496.1, 1 a.a. - 251 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HDHD3 (Haloacid Dehalogenase Like Hydrolase Domain Containing 3) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity.
Molecular Mass : 54.4 kDa
AA Sequence : MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HDHD3 haloacid dehalogenase-like hydrolase domain containing 3 [ Homo sapiens ]
Official Symbol HDHD3
Synonyms HDHD3; haloacid dehalogenase-like hydrolase domain containing 3; C9orf158, chromosome 9 open reading frame 158; haloacid dehalogenase-like hydrolase domain-containing protein 3; MGC12904; C9orf158; 2810435D12Rik;
Gene ID 81932
mRNA Refseq NM_031219
Protein Refseq NP_112496
UniProt ID Q9BSH5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HDHD3 Products

Required fields are marked with *

My Review for All HDHD3 Products

Required fields are marked with *

0
cart-icon