Recombinant Human HDHD3 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | HDHD3-4839H |
| Product Overview : | HDHD3 MS Standard C13 and N15-labeled recombinant protein (NP_112496) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Belongs to the HAD-like hydrolase superfamily. |
| Molecular Mass : | 28 kDa |
| AA Sequence : | MAHRLQIRLLTWDVKDTLLRLRHPLGEAYATKARAHGLEVEPSALEQGFRQAYRAQSHSFPNYGLSHGLTSRQWWLDVVLQTFHLAGVQDAQAVAPIAEQLYKDFSHPCTWQVLDGAEDTLRECRTRGLRLAVISNFDRRLEGILGGLGLREHFDFVLTSEAAGWPKPDPRIFQEALRLAHMEPVVAAHVGDNYLCDYQGPRAVGMHSFLVVGPQALDPVVRDSVPKEHILPSLAHLLPALDCLEGSTPGLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | HDHD3 haloacid dehalogenase-like hydrolase domain containing 3 [ Homo sapiens (human) ] |
| Official Symbol | HDHD3 |
| Synonyms | HDHD3; haloacid dehalogenase-like hydrolase domain containing 3; C9orf158, chromosome 9 open reading frame 158; haloacid dehalogenase-like hydrolase domain-containing protein 3; MGC12904; C9orf158; 2810435D12Rik; |
| Gene ID | 81932 |
| mRNA Refseq | NM_031219 |
| Protein Refseq | NP_112496 |
| UniProt ID | Q9BSH5 |
| ◆ Recombinant Proteins | ||
| HDHD3-4665H | Recombinant Human HDHD3 Protein, GST-tagged | +Inquiry |
| HDHD3-2058R | Recombinant Rhesus monkey HDHD3 Protein, His-tagged | +Inquiry |
| HDHD3-7544M | Recombinant Mouse HDHD3 Protein | +Inquiry |
| HDHD3-3444HF | Recombinant Full Length Human HDHD3 Protein, GST-tagged | +Inquiry |
| HDHD3-1879R | Recombinant Rhesus Macaque HDHD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HDHD3-5594HCL | Recombinant Human HDHD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HDHD3 Products
Required fields are marked with *
My Review for All HDHD3 Products
Required fields are marked with *
