Recombinant Human HECTD2 protein, Myc/DDK-tagged
Cat.No. : | HECTD2-4H |
Product Overview : | Recombinant Human HECTD2 protein, fused to Myc/DDK-tag, was expressed in HEK293T. Protein Families: Druggable Genome. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 87.9 kDa |
AA Sequence : | myc-FLAG tag |
Product-Related Proteins : | TA50011-100 LC403656 TA331541 LC403656 TA331541 RC207254 |
Purity : | > 80% |
Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL |
Gene Name | HECTD2 HECT domain E3 ubiquitin protein ligase 2 [ Homo sapiens (human) ] |
Official Symbol | HECTD2 |
Synonyms | FLJ16050 |
Gene ID | 143279 |
mRNA Refseq | NM_182765.6 |
Protein Refseq | NP_877497.4 |
UniProt ID | Q5U5R9 |
◆ Recombinant Proteins | ||
HECTD2-4H | Recombinant Human HECTD2 protein, Myc/DDK-tagged | +Inquiry |
HECTD2-2241H | Recombinant Human HECTD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HECTD2-20H | Recombinant Human HECTD2 protein, His-tagged | +Inquiry |
HECTD2-4677H | Recombinant Human HECTD2 Protein, GST-tagged | +Inquiry |
HECTD2-21H | Recombinant Human HECTD2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HECTD2-5591HCL | Recombinant Human HECTD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HECTD2 Products
Required fields are marked with *
My Review for All HECTD2 Products
Required fields are marked with *