Recombinant Human HECTD2 protein, Myc/DDK-tagged
Cat.No. : | HECTD2-4H |
Product Overview : | Recombinant Human HECTD2 protein, fused to Myc/DDK-tag, was expressed in HEK293T. Protein Families: Druggable Genome. |
- Specification
- Gene Information
- Related Products
Description : | Probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. |
Source : | HEK293T |
Species : | Human |
Tag : | Myc/DDK |
Form : | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 87.9 kDa |
AA Sequence : | myc-FLAG tag |
Product-Related Proteins : | TA50011-100 LC403656 TA331541 LC403656 TA331541 RC207254 |
Purity : | > 80% |
Usage : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL |
Gene Name : | HECTD2 HECT domain E3 ubiquitin protein ligase 2 [ Homo sapiens (human) ] |
Official Symbol : | HECTD2 |
Synonyms : | FLJ16050 |
Gene ID : | 143279 |
mRNA Refseq : | NM_182765.6 |
Protein Refseq : | NP_877497.4 |
UniProt ID : | Q5U5R9 |
Products Types
◆ Recombinant Protein | ||
HECTD2-4677H | Recombinant Human HECTD2 Protein, GST-tagged | +Inquiry |
Hectd2-3378M | Recombinant Mouse Hectd2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Lysates | ||
HECTD2-5591HCL | Recombinant Human HECTD2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket