Recombinant Full Length Human HECTD2 Protein, GST-tagged
Cat.No. : | HECTD2-3459HF |
Product Overview : | Human HECTD2 full-length ORF ( NP_775768.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 207 amino acids |
Description : | HECTD2 (HECT Domain E3 Ubiquitin Protein Ligase 2) is a Protein Coding gene. Among its related pathways are Innate Immune System and Class I MHC mediated antigen processing and presentation. GO annotations related to this gene include ligase activity and ubiquitin-protein transferase activity. An important paralog of this gene is UBE3A. |
Molecular Mass : | 48.7 kDa |
AA Sequence : | MSEAVRVPSPATPLVVAAAAPEERKGKESEREKLPPIVSAGAGATAGLDRGAKGQISTFSSFISAVSPKKEAAENRSSPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKAVHDFYLTTFDSFPELNAAFKKDATASFNTIEDSGINAKFVNAVYDTLLNTVSIMTCK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HECTD2 HECT domain containing E3 ubiquitin protein ligase 2 [ Homo sapiens ] |
Official Symbol | HECTD2 |
Synonyms | HECTD2; HECT domain containing E3 ubiquitin protein ligase 2; HECT domain containing 2; probable E3 ubiquitin-protein ligase HECTD2; FLJ37306; HECT domain-containing protein 2; FLJ16050; |
Gene ID | 143279 |
mRNA Refseq | NM_173497 |
Protein Refseq | NP_775768 |
UniProt ID | Q5U5R9 |
◆ Recombinant Proteins | ||
HECTD2-4677H | Recombinant Human HECTD2 Protein, GST-tagged | +Inquiry |
Hectd2-3378M | Recombinant Mouse Hectd2 Protein, Myc/DDK-tagged | +Inquiry |
HECTD2-4H | Recombinant Human HECTD2 protein, Myc/DDK-tagged | +Inquiry |
HECTD2-2241H | Recombinant Human HECTD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HECTD2-20H | Recombinant Human HECTD2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HECTD2-5591HCL | Recombinant Human HECTD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HECTD2 Products
Required fields are marked with *
My Review for All HECTD2 Products
Required fields are marked with *