Recombinant Human HECTD2 protein, His-tagged
Cat.No. : | HECTD2-21H |
Product Overview : | Recombinant Human HECTD2 protein(Pro21-Lys170)(Q5U5R9) was expressed in E. coli with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 21-170 a.a. |
Tag : | His |
Form : | Phosphate buffered saline |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | PEERKGKESEREKLPPIVSAGAGATAGLDRGAKGQISTFSSFISAVSPKKEAAENRSSPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKAVHDFYLTTFDSFPELNAAFK |
Gene Name | HECTD2 HECT domain containing E3 ubiquitin protein ligase 2 [ Homo sapiens ] |
Official Symbol | HECTD2 |
Synonyms | HECTD2; HECT domain containing E3 ubiquitin protein ligase 2; HECT domain containing 2; probable E3 ubiquitin-protein ligase HECTD2; FLJ37306; HECT domain-containing protein 2; FLJ16050; |
Gene ID | 143279 |
mRNA Refseq | NM_173497 |
Protein Refseq | NP_775768 |
UniProt ID | Q5U5R9 |
◆ Recombinant Proteins | ||
HECTD2-20H | Recombinant Human HECTD2 protein, His-tagged | +Inquiry |
HECTD2-3459HF | Recombinant Full Length Human HECTD2 Protein, GST-tagged | +Inquiry |
HECTD2-2241H | Recombinant Human HECTD2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HECTD2-21H | Recombinant Human HECTD2 protein, His-tagged | +Inquiry |
Hectd2-3378M | Recombinant Mouse Hectd2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HECTD2-5591HCL | Recombinant Human HECTD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HECTD2 Products
Required fields are marked with *
My Review for All HECTD2 Products
Required fields are marked with *
0
Inquiry Basket