Recombinant Human HECTD2 protein, His-tagged

• Cat.No.: HECTD2-21H
• Product Overview: Recombinant Human HECTD2 protein(Pro21-Lys170)(Q5U5R9) was expressed in E. coli with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-170 a.a.
• Tag: His
• Form: Phosphate buffered saline
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: PEERKGKESEREKLPPIVSAGAGATAGLDRGAKGQISTFSSFISAVSPKKEAAENRSSPAHLVFPNIKNVREPPPICLDVRQKQRTSMDASSSEMKAPVLPEPILPIQPKTVKDFQEDVEKVKSSGDWKAVHDFYLTTFDSFPELNAAFK

Gene Information

• Gene Name: HECTD2 HECT domain containing E3 ubiquitin protein ligase 2 [ Homo sapiens ]
• Official Symbol: HECTD2
• Synonyms: HECTD2; HECT domain containing E3 ubiquitin protein ligase 2; HECT domain containing 2; probable E3 ubiquitin-protein ligase HECTD2; FLJ37306; HECT domain-containing protein 2; FLJ16050
• Gene ID: 143279
• mRNA Refseq: NM_173497
• Protein Refseq: NP_775768
• UniProt ID: Q5U5R9