Recombinant Human HEMGN protein, GST-tagged
Cat.No. : | HEMGN-13733H |
Product Overview : | Recombinant Human HEMGN protein(139-483 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 139-483 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | SNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSEDYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | HEMGN hemogen [ Homo sapiens ] |
Official Symbol | HEMGN |
Synonyms | HEMGN; hemogen; EDAG; hemopoietic gene protein; negative differentiation regulator protein; erythroid differentiation-associated gene protein; EDAG-1; |
Gene ID | 55363 |
mRNA Refseq | NM_018437 |
Protein Refseq | NP_060907 |
MIM | 610715 |
UniProt ID | Q9BXL5 |
◆ Recombinant Proteins | ||
HEMGN-2479R | Recombinant Rat HEMGN Protein, His (Fc)-Avi-tagged | +Inquiry |
HEMGN-13733H | Recombinant Human HEMGN protein, GST-tagged | +Inquiry |
HEMGN-2824R | Recombinant Rat HEMGN Protein | +Inquiry |
HEMGN-4651H | Recombinant Human HEMGN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HEMGN-3475HF | Recombinant Full Length Human HEMGN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEMGN-5588HCL | Recombinant Human HEMGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEMGN Products
Required fields are marked with *
My Review for All HEMGN Products
Required fields are marked with *