Recombinant Human HEMGN Protein, GST-tagged
Cat.No. : | HEMGN-4686H |
Product Overview : | Human HEMGN full-length ORF ( NP_060907.2, 1 a.a. - 484 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | HEMGN (Hemogen) is a Protein Coding gene. Diseases associated with HEMGN include Isolated Cleft Lip. |
Molecular Mass : | 81.7 kDa |
AA Sequence : | MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGKGNRRGRKRQQNTELKVEPQPQIEKEIVEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQESNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSEDYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HEMGN hemogen [ Homo sapiens ] |
Official Symbol | HEMGN |
Synonyms | HEMGN; hemogen; EDAG; hemopoietic gene protein; negative differentiation regulator protein; erythroid differentiation-associated gene protein; EDAG-1; |
Gene ID | 55363 |
mRNA Refseq | NM_018437 |
Protein Refseq | NP_060907 |
MIM | 610715 |
UniProt ID | Q9BXL5 |
◆ Recombinant Proteins | ||
HEMGN-13733H | Recombinant Human HEMGN protein, GST-tagged | +Inquiry |
HEMGN-4686H | Recombinant Human HEMGN Protein, GST-tagged | +Inquiry |
HEMGN-3475HF | Recombinant Full Length Human HEMGN Protein, GST-tagged | +Inquiry |
HEMGN-2479R | Recombinant Rat HEMGN Protein, His (Fc)-Avi-tagged | +Inquiry |
HEMGN-7571M | Recombinant Mouse HEMGN Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HEMGN-5588HCL | Recombinant Human HEMGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEMGN Products
Required fields are marked with *
My Review for All HEMGN Products
Required fields are marked with *