Recombinant Human HEMGN Protein, GST-tagged
| Cat.No. : | HEMGN-4686H |
| Product Overview : | Human HEMGN full-length ORF ( NP_060907.2, 1 a.a. - 484 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HEMGN (Hemogen) is a Protein Coding gene. Diseases associated with HEMGN include Isolated Cleft Lip. |
| Molecular Mass : | 81.7 kDa |
| AA Sequence : | MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEKETSQWLFGEQKKRKQQRTGKGNRRGRKRQQNTELKVEPQPQIEKEIVEKALAPIEKKTEPPGSITKVFPSVASPQKVVPEEHFSEICQESNIYQENFSEYQEIAVQNHSSETCQHVSEPEDLSPKMYQEISVLQDNSSKICQDMKEPEDNSPNTCQVISVIQDHPFKMYQDMAKREDLAPKMCQEAAVPKILPCPTSEDTADLAGCSLQAYPKPDVPKGYILDTDQNPAEPEEYNETDQGIAETEGLFPKIQEIAEPKDLSTKTHQESAEPKYLPHKTCNEIIVPKAPSHKTIQETPHSEDYSIEINQETPGSEKYSPETYQEIPGLEEYSPEIYQETSQLEEYSPEIYQETPGPEDLSTETYKNKDVPKECFPEPHQETGGPQGQDPKAHQEDAKDAYTFPQEMKEKPKEEPGIPAILNESHPENDVYSYVLF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HEMGN hemogen [ Homo sapiens ] |
| Official Symbol | HEMGN |
| Synonyms | HEMGN; hemogen; EDAG; hemopoietic gene protein; negative differentiation regulator protein; erythroid differentiation-associated gene protein; EDAG-1; |
| Gene ID | 55363 |
| mRNA Refseq | NM_018437 |
| Protein Refseq | NP_060907 |
| MIM | 610715 |
| UniProt ID | Q9BXL5 |
| ◆ Recombinant Proteins | ||
| HEMGN-4121M | Recombinant Mouse HEMGN Protein, His (Fc)-Avi-tagged | +Inquiry |
| HEMGN-13733H | Recombinant Human HEMGN protein, GST-tagged | +Inquiry |
| HEMGN-2479R | Recombinant Rat HEMGN Protein, His (Fc)-Avi-tagged | +Inquiry |
| HEMGN-4686H | Recombinant Human HEMGN Protein, GST-tagged | +Inquiry |
| HEMGN-3475HF | Recombinant Full Length Human HEMGN Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HEMGN-5588HCL | Recombinant Human HEMGN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEMGN Products
Required fields are marked with *
My Review for All HEMGN Products
Required fields are marked with *
