Recombinant Human HEPH Protein, GST-tagged
| Cat.No. : | HEPH-4689H |
| Product Overview : | Human HEPH partial ORF ( NP_620074, 315 a.a. - 424 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is similar to an iron transport protein found in mouse. The mouse protein is similar to ceruloplasmin, a serum multi-copper ferroxidase, and is thought to be a membrane-bound protein responsible for transport of dietary iron from epithelial cells of the intestinal lumen into the circulatory system. In mouse, defects in this gene can lead to severe microcytic anemia. Three transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq |
| Molecular Mass : | 37.84 kDa |
| AA Sequence : | TRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKSSSRI |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HEPH hephaestin [ Homo sapiens ] |
| Official Symbol | HEPH |
| Synonyms | HEPH; hephaestin; CPL; KIAA0698; |
| Gene ID | 9843 |
| mRNA Refseq | NM_001130860 |
| Protein Refseq | NP_001124332 |
| MIM | 300167 |
| UniProt ID | Q9BQS7 |
| ◆ Recombinant Proteins | ||
| HEPH-4689H | Recombinant Human HEPH Protein, GST-tagged | +Inquiry |
| HEPH-2741H | Recombinant Human HEPH Protein (Ala24-Cys366), His tagged | +Inquiry |
| HEPH-1596H | Recombinant Human HEPH protein, His-tagged | +Inquiry |
| HEPH-902HFL | Recombinant Full Length Human HEPH Protein, C-Flag-tagged | +Inquiry |
| HEPH-2481R | Recombinant Rat HEPH Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HEPH-5586HCL | Recombinant Human HEPH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HEPH Products
Required fields are marked with *
My Review for All HEPH Products
Required fields are marked with *
