Recombinant Human HEPH Protein, GST-tagged

Cat.No. : HEPH-4689H
Product Overview : Human HEPH partial ORF ( NP_620074, 315 a.a. - 424 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is similar to an iron transport protein found in mouse. The mouse protein is similar to ceruloplasmin, a serum multi-copper ferroxidase, and is thought to be a membrane-bound protein responsible for transport of dietary iron from epithelial cells of the intestinal lumen into the circulatory system. In mouse, defects in this gene can lead to severe microcytic anemia. Three transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : TRGHHTDVANIFPATFVTAEMVPWEPGTWLISCQVNSHFRDGMQALYKVKSCSMAPPVDLLTGKVRQYFIEAHEIQWDYGPMGHDGSTGKNLREPGSISDKFFQKSSSRI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HEPH hephaestin [ Homo sapiens ]
Official Symbol HEPH
Synonyms HEPH; hephaestin; CPL; KIAA0698;
Gene ID 9843
mRNA Refseq NM_001130860
Protein Refseq NP_001124332
MIM 300167
UniProt ID Q9BQS7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HEPH Products

Required fields are marked with *

My Review for All HEPH Products

Required fields are marked with *

0
cart-icon