Recombinant Human HERC4 Protein, GST-tagged
| Cat.No. : | HERC4-4692H |
| Product Overview : | Human HERC4 partial ORF ( NP_071362, 341 a.a. - 440 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HERC4 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).[supplied by OMIM |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | VKGNWYPYNGQCLPDIDSEEYFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCPNPTKQIWTVNEALIQKWLSYPSGRFPVEIANEIDGTFSSSGCLNGSF |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HERC4 HECT and RLD domain containing E3 ubiquitin protein ligase 4 [ Homo sapiens ] |
| Official Symbol | HERC4 |
| Synonyms | HERC4; HECT and RLD domain containing E3 ubiquitin protein ligase 4; hect domain and RLD 4; probable E3 ubiquitin-protein ligase HERC4; DKFZP564G092; KIAA1593; HECT domain and RCC1-like domain-containing protein 4; DKFZp564G092; |
| Gene ID | 26091 |
| mRNA Refseq | NM_015601 |
| Protein Refseq | NP_056416 |
| MIM | 609248 |
| UniProt ID | Q5GLZ8 |
| ◆ Recombinant Proteins | ||
| HERC4-13739H | Recombinant Human HERC4, GST-tagged | +Inquiry |
| HERC4-1889R | Recombinant Rhesus Macaque HERC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HERC4-4692H | Recombinant Human HERC4 Protein, GST-tagged | +Inquiry |
| HERC4-4128M | Recombinant Mouse HERC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HERC4-637H | Active Recombinant Human HERC4 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HERC4 Products
Required fields are marked with *
My Review for All HERC4 Products
Required fields are marked with *
