Recombinant Human HERC5 Protein, GST-tagged

Cat.No. : HERC5-4693H
Product Overview : Human HERC5 partial ORF ( NP_057407, 915 a.a. - 1024 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : YDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HERC5 HECT and RLD domain containing E3 ubiquitin protein ligase 5 [ Homo sapiens ]
Official Symbol HERC5
Synonyms HERC5; HECT and RLD domain containing E3 ubiquitin protein ligase 5; hect domain and RLD 5; E3 ISG15--protein ligase HERC5; CEB1; cyclin-E-binding protein 1; probable E3 ubiquitin-protein ligase HERC5; HECT domain and RCC1-like domain-containing protein 5; CEBP1;
Gene ID 51191
mRNA Refseq NM_016323
Protein Refseq NP_057407
MIM 608242
UniProt ID Q9UII4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HERC5 Products

Required fields are marked with *

My Review for All HERC5 Products

Required fields are marked with *

0
cart-icon
0
compare icon