Recombinant Human HERC6 Protein, GST-tagged

Cat.No. : HERC6-4694H
Product Overview : Human HERC6 partial ORF ( NP_060382, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).[supplied by OMIM
Molecular Mass : 36.74 kDa
AA Sequence : AYVHTTGQVVSFGHGPSDTSKPTHPEALTENFDISCLISAEDFVDVQVKHIFAGTYANFVTTHQDTSSTRAPGKTLPEISRISQSMAEKWIAVKRRSTEH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HERC6 HECT and RLD domain containing E3 ubiquitin protein ligase family member 6 [ Homo sapiens ]
Official Symbol HERC6
Synonyms HERC6; HECT and RLD domain containing E3 ubiquitin protein ligase family member 6; hect domain and RLD 6; probable E3 ubiquitin-protein ligase HERC6; FLJ20637; potential ubiquitin ligase; HECT domain and RCC1-like domain-containing protein 6;
Gene ID 55008
mRNA Refseq NM_001165136
Protein Refseq NP_001158608
MIM 609249
UniProt ID Q8IVU3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HERC6 Products

Required fields are marked with *

My Review for All HERC6 Products

Required fields are marked with *

0
cart-icon
0
compare icon