Recombinant Human HERC6 Protein, GST-tagged
| Cat.No. : | HERC6-4694H |
| Product Overview : | Human HERC6 partial ORF ( NP_060382, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HERC6 belongs to the HERC family of ubiquitin ligases, all of which contain a HECT domain and at least 1 RCC1 (MIM 179710)-like domain (RLD). The 350-amino acid HECT domain is predicted to catalyze the formation of a thioester with ubiquitin before transferring it to a substrate, and the RLD is predicted to act as a guanine nucleotide exchange factor for small G proteins (Hochrainer et al., 2005 [PubMed 15676274]).[supplied by OMIM |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | AYVHTTGQVVSFGHGPSDTSKPTHPEALTENFDISCLISAEDFVDVQVKHIFAGTYANFVTTHQDTSSTRAPGKTLPEISRISQSMAEKWIAVKRRSTEH |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HERC6 HECT and RLD domain containing E3 ubiquitin protein ligase family member 6 [ Homo sapiens ] |
| Official Symbol | HERC6 |
| Synonyms | HERC6; HECT and RLD domain containing E3 ubiquitin protein ligase family member 6; hect domain and RLD 6; probable E3 ubiquitin-protein ligase HERC6; FLJ20637; potential ubiquitin ligase; HECT domain and RCC1-like domain-containing protein 6; |
| Gene ID | 55008 |
| mRNA Refseq | NM_001165136 |
| Protein Refseq | NP_001158608 |
| MIM | 609249 |
| UniProt ID | Q8IVU3 |
| ◆ Recombinant Proteins | ||
| HERC6-7583M | Recombinant Mouse HERC6 Protein | +Inquiry |
| HERC6-4694H | Recombinant Human HERC6 Protein, GST-tagged | +Inquiry |
| HERC6-4129M | Recombinant Mouse HERC6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| HERC6-13741H | Recombinant Human HERC6, His-tagged | +Inquiry |
| HERC6-1093H | Recombinant Human HERC6 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HERC6 Products
Required fields are marked with *
My Review for All HERC6 Products
Required fields are marked with *
