Recombinant Human HES1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | HES1-500H |
Product Overview : | HES1 MS Standard C13 and N15-labeled recombinant protein (NP_005515) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box. |
Molecular Mass : | 29.4 kDa |
AA Sequence : | MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | HES1 hes family bHLH transcription factor 1 [ Homo sapiens (human) ] |
Official Symbol | HES1 |
Synonyms | HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila), HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1; hairy homolog; hairy-like protein; class B basic helix-loop-helix protein 39; HHL; HRY; HES-1; |
Gene ID | 3280 |
mRNA Refseq | NM_005524 |
Protein Refseq | NP_005515 |
MIM | 139605 |
UniProt ID | Q14469 |
◆ Recombinant Proteins | ||
HES1-1062H | Recombinant Human HES1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HES1-2972H | Recombinant Human HES1 protein, His-tagged | +Inquiry |
Hes1-1111M | Recombinant Mouse Hes1 Protein, MYC/DDK-tagged | +Inquiry |
HES1-500H | Recombinant Human HES1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HES1-1831HFL | Recombinant Full Length Human HES1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HES1-5582HCL | Recombinant Human HES1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HES1 Products
Required fields are marked with *
My Review for All HES1 Products
Required fields are marked with *