Recombinant Human HFE Protein, GST-tagged

• Cat.No.: HFE-4721H
• Product Overview: Human HFE partial ORF ( NP_000401, 115 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. [provided by RefSeq
• Molecular Mass: 35.75 kDa
• AA Sequence: SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HFE hemochromatosis [ Homo sapiens ]
• Official Symbol: HFE
• Synonyms: HFE; hemochromatosis; hereditary hemochromatosis protein; high Fe; HLA H; MHC class I-like protein HFE; hereditary hemochromatosis protein HLA-H; HH; HFE1; HLA-H; MVCD7; TFQTL2; MGC103790; MGC:150812; dJ221C16.10.1; IMAGE:40125754
• Gene ID: 3077
• mRNA Refseq: NM_000410
• Protein Refseq: NP_000401
• MIM: 613609
• UniProt ID: Q30201