Recombinant Human HFE Protein, GST-tagged

Cat.No. : HFE-4721H
Product Overview : Human HFE partial ORF ( NP_000401, 115 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a membrane protein that is similar to MHC class I-type proteins and associates with beta2-microglobulin (beta2M). It is thought that this protein functions to regulate iron absorption by regulating the interaction of the transferrin receptor with transferrin. The iron storage disorder, hereditary haemochromatosis, is a recessive genetic disorder that results from defects in this gene. At least nine alternatively spliced variants have been described for this gene. Additional variants have been found but their full-length nature has not been determined. [provided by RefSeq
Molecular Mass : 35.75 kDa
AA Sequence : SHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCPDTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRGVLDQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HFE hemochromatosis [ Homo sapiens ]
Official Symbol HFE
Synonyms HFE; hemochromatosis; hereditary hemochromatosis protein; high Fe; HLA H; MHC class I-like protein HFE; hereditary hemochromatosis protein HLA-H; HH; HFE1; HLA-H; MVCD7; TFQTL2; MGC103790; MGC:150812; dJ221C16.10.1; IMAGE:40125754;
Gene ID 3077
mRNA Refseq NM_000410
Protein Refseq NP_000401
MIM 613609
UniProt ID Q30201

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HFE Products

Required fields are marked with *

My Review for All HFE Products

Required fields are marked with *

0
cart-icon
0
compare icon