Recombinant Human HIBADH Protein, GST-tagged
Cat.No. : | HIBADH-4742H |
Product Overview : | Human HIBADH full-length ORF ( NP_689953.1, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM |
Molecular Mass : | 61.7 kDa |
AA Sequence : | MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIBADH 3-hydroxyisobutyrate dehydrogenase [ Homo sapiens ] |
Official Symbol | HIBADH |
Synonyms | HIBADH; 3-hydroxyisobutyrate dehydrogenase; 3-hydroxyisobutyrate dehydrogenase, mitochondrial; NS5ATP1; MGC40361; |
Gene ID | 11112 |
mRNA Refseq | NM_152740 |
Protein Refseq | NP_689953 |
MIM | 608475 |
UniProt ID | P31937 |
◆ Recombinant Proteins | ||
HIBADH-2239H | Recombinant Human HIBADH Protein, His-tagged | +Inquiry |
HIBADH-2839R | Recombinant Rat HIBADH Protein | +Inquiry |
HIBADH-246H | Recombinant Human HIBADH Protein, MYC/DDK-tagged | +Inquiry |
HIBADH-7618M | Recombinant Mouse HIBADH Protein | +Inquiry |
HIBADH-4158M | Recombinant Mouse HIBADH Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIBADH-785HCL | Recombinant Human HIBADH cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HIBADH Products
Required fields are marked with *
My Review for All HIBADH Products
Required fields are marked with *
0
Inquiry Basket