Recombinant Human HIC1
Cat.No. : | HIC1-29312TH |
Product Overview : | Recombinant fragment corresponding to amino acids 627-705 of Human HIC1 with N terminal proprietary tag; Predicted MWt 34.32 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 79 amino acids |
Description : | This gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants. |
Molecular Weight : | 34.320kDa inclusive of tags |
Tissue specificity : | Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | PEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDG |
Sequence Similarities : | Belongs to the krueppel C2H2-type zinc-finger protein family. Hic subfamily.Contains 1 BTB (POZ) domain.Contains 5 C2H2-type zinc fingers. |
Gene Name | HIC1 hypermethylated in cancer 1 [ Homo sapiens ] |
Official Symbol | HIC1 |
Synonyms | HIC1; hypermethylated in cancer 1; hypermethylated in cancer 1 protein; ZBTB29; ZNF901; |
Gene ID | 3090 |
mRNA Refseq | NM_001098202 |
Protein Refseq | NP_001091672 |
MIM | 603825 |
Uniprot ID | Q14526 |
Chromosome Location | 17p13.3 |
Pathway | Direct p53 effectors, organism-specific biosystem; E2F transcription factor network, organism-specific biosystem; |
Function | DNA binding; histone deacetylase binding; metal ion binding; protein binding; sequence-specific DNA binding; |
◆ Recombinant Proteins | ||
HIC1-6789C | Recombinant Chicken HIC1 | +Inquiry |
HIC1-245H | Recombinant Human HIC1 Protein, MYC/DDK-tagged | +Inquiry |
HIC1-7620M | Recombinant Mouse HIC1 Protein | +Inquiry |
HIC1-29312TH | Recombinant Human HIC1 | +Inquiry |
HIC1-463Z | Recombinant Zebrafish HIC1 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIC1 Products
Required fields are marked with *
My Review for All HIC1 Products
Required fields are marked with *