Recombinant Human HIF1A, GST-tagged

Cat.No. : HIF1A-106H
Product Overview : Human HIF1A full-length ORF ( NP_851397.1, 1 a.a. - 735 a.a.) recombinant protein with GST-tag at N-terminal.
Availability October 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Hypoxia-inducible factor-1 (HIF-1), identified as one of the transcription factors, has been found to play an essential role in oxygen homeostasis. HIF-1 is a heterodimer composed of HIF-1β subunit and one of three subunits(Hif-1α, Hif-2( or Hif-3)). The activation of Hif-1( is closely associated with a variety of tumors and oncogenic pathways. Hif-1( consists of DNA binding domain(DBD domain), Dimerization domain and C-terminla regulatiory domains, including two transactivation domains(TAD), an oxygen-dependent degradation(ODD) domain, and inhibitory domains.
Form : Liquid
Molecular Mass : 109.1 kDa
AA Sequence : MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDA GDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTH RNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICE PIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLF TKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAM SPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDS DMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKG VIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGII
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) [ Homo sapiens ]
Official Symbol HIF1A
Synonyms HIF1A; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor 1-alpha; bHLHe78; HIF 1alpha; HIF1; MOP1; PASD8; HIF-1-alpha; member of PAS protein 1; ARNT interacting protein; ARNT-interacting protein; member of PAS superfamily 1; PAS domain-containing protein 8; basic-helix-loop-helix-PAS protein MOP1; class E basic helix-loop-helix protein 78; hypoxia-inducible factor 1 alpha isoform I.3; hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); HIF-1alpha; HIF1-ALPHA;
Gene ID 3091
mRNA Refseq NM_001243084
Protein Refseq NP_001230013
MIM 603348
UniProt ID Q16665
Chromosome Location 14q23.2
Pathway Adipogenesis, organism-specific biosystem; Angiogenesis, organism-specific biosystem; Circadian Clock, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hypoxic and oxygen homeostasis regulation of HIF-1-alpha, organism-specific biosystem; NOTCH1 Intracellular Domain Regulates Transcription, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem;
Function Hsp90 protein binding; histone acetyltransferase binding; histone deacetylase binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; protein kinase binding; contributes_to sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; contributes_to sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; signal transducer activity; transcription factor binding; transcription regulatory region DNA binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIF1A Products

Required fields are marked with *

My Review for All HIF1A Products

Required fields are marked with *

0
cart-icon
0
compare icon