Recombinant Human HIF1A, GST-tagged
Cat.No. : | HIF1A-106H |
Product Overview : | Human HIF1A full-length ORF ( NP_851397.1, 1 a.a. - 735 a.a.) recombinant protein with GST-tag at N-terminal. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Hypoxia-inducible factor-1 (HIF-1), identified as one of the transcription factors, has been found to play an essential role in oxygen homeostasis. HIF-1 is a heterodimer composed of HIF-1β subunit and one of three subunits(Hif-1α, Hif-2( or Hif-3)). The activation of Hif-1( is closely associated with a variety of tumors and oncogenic pathways. Hif-1( consists of DNA binding domain(DBD domain), Dimerization domain and C-terminla regulatiory domains, including two transactivation domains(TAD), an oxygen-dependent degradation(ODD) domain, and inhibitory domains. |
Form : | Liquid |
Molecular Mass : | 109.1 kDa |
AA Sequence : | MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVMRLTISYLRVRKLLDA GDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTH RNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICE PIPHPSNIEIPLDSKTFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECVLKPVESSDMKMTQLF TKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAM SPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDS DMVNEFKLELVEKLFAEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYRDTQSRTASPNRAGKG VIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKRKMEHDGSLFQAVGII |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIF1A hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) [ Homo sapiens ] |
Official Symbol | HIF1A |
Synonyms | HIF1A; hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); hypoxia-inducible factor 1-alpha; bHLHe78; HIF 1alpha; HIF1; MOP1; PASD8; HIF-1-alpha; member of PAS protein 1; ARNT interacting protein; ARNT-interacting protein; member of PAS superfamily 1; PAS domain-containing protein 8; basic-helix-loop-helix-PAS protein MOP1; class E basic helix-loop-helix protein 78; hypoxia-inducible factor 1 alpha isoform I.3; hypoxia-inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor); HIF-1alpha; HIF1-ALPHA; |
Gene ID | 3091 |
mRNA Refseq | NM_001243084 |
Protein Refseq | NP_001230013 |
MIM | 603348 |
UniProt ID | Q16665 |
Chromosome Location | 14q23.2 |
Pathway | Adipogenesis, organism-specific biosystem; Angiogenesis, organism-specific biosystem; Circadian Clock, organism-specific biosystem; HIF-1-alpha transcription factor network, organism-specific biosystem; Hypoxic and oxygen homeostasis regulation of HIF-1-alpha, organism-specific biosystem; NOTCH1 Intracellular Domain Regulates Transcription, organism-specific biosystem; Notch-mediated HES/HEY network, organism-specific biosystem; |
Function | Hsp90 protein binding; histone acetyltransferase binding; histone deacetylase binding; protein binding; protein heterodimerization activity; protein heterodimerization activity; protein kinase binding; contributes_to sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; sequence-specific DNA binding transcription factor activity; sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; contributes_to sequence-specific distal enhancer binding RNA polymerase II transcription factor activity; signal transducer activity; transcription factor binding; transcription regulatory region DNA binding; |
◆ Recombinant Proteins | ||
HIF1A-0487H | Recombinant Human HIF1A Protein (E2-N826), His/Strep tagged | +Inquiry |
HIF1A-7714C | Recombinant Chicken HIF1A protein, His-tagged | +Inquiry |
Hif1a-153R | Recombinant Rat Hif1a protein, His/S-tagged | +Inquiry |
HIF1A-01H | Recombinant Full Length Human HIF1A Protein, N-GST-tagged | +Inquiry |
HIF1A-6935H | Recombinant Human Hypoxia Inducible Factor 1, Alpha Subunit (basic helix-loop-helix transcription factor) | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIF1A-787HCL | Recombinant Human HIF1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIF1A Products
Required fields are marked with *
My Review for All HIF1A Products
Required fields are marked with *
0
Inquiry Basket