Recombinant Human HIST2H3C Protein, GST-tagged
Cat.No. : | HIST2H3C-4813H |
Product Overview : | Human HIST2H3C full-length ORF ( AAI53075.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. This structure consists of approximately 146 bp of DNA wrapped around a nucleosome, an octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is found in a histone cluster on chromosome 1. This gene is one of four histone genes in the cluster that are duplicated; this record represents the telomeric copy. [provided by RefSeq |
Molecular Mass : | 41.91 kDa |
AA Sequence : | MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HIST2H3C histone cluster 2, H3c [ Homo sapiens ] |
Official Symbol | HIST2H3C |
Synonyms | H3; H3.2; H3/M; H3F2; H3FM; H3FN |
Gene ID | 126961 |
mRNA Refseq | NM_021059 |
Protein Refseq | NP_066403 |
MIM | 142780 |
UniProt ID | Q71DI3 |
◆ Recombinant Proteins | ||
HIST2H3C-4813H | Recombinant Human HIST2H3C Protein, GST-tagged | +Inquiry |
HIST2H3C-5890Z | Recombinant Zebrafish HIST2H3C | +Inquiry |
HIST2H3C-3603HF | Recombinant Full Length Human HIST2H3C Protein, GST-tagged | +Inquiry |
HIST2H3C-114H | Recombinant Human HIST2H3C Protein, HIS-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HIST2H3C-5515HCL | Recombinant Human HIST2H3C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HIST2H3C Products
Required fields are marked with *
My Review for All HIST2H3C Products
Required fields are marked with *
0
Inquiry Basket