Recombinant Human HIST3H3 protein, His-tagged

Cat.No. : HIST3H3-299H
Product Overview : Recombinant Human HIST3H3(2–136 aa) fused with N-terminal Met-Ala-Cys-6xHis-tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-236 a.a.
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
Form : 8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 20% glycerol and 3 mM DTT.
Molecular Mass : 16.3 kDa
AA Sequence : MACHHHHHHARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP FQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
Applications : Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
Storage : > 6 months at -80 centigrade. Avoid freeze/thaw cycles.
Concentration : 0.10 mg/ml
Gene Name HIST3H3 histone cluster 3, H3 [ Homo sapiens ]
Official Symbol HIST3H3
Synonyms HIST3H3; histone cluster 3, H3; H3 histone family, member T , H3FT, histone 3, H3; histone H3.1t; H3/g; H3t; H3/t; histone 3, H3; H3 histone family, member T; H3.4; H3FT; MGC126886; MGC126888;
Gene ID 8290
mRNA Refseq NM_003493
Protein Refseq NP_003484
MIM 602820
UniProt ID Q16695
Chromosome Location 1q42.13
Pathway Cell Cycle, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Meiosis, organism-specific biosystem; Meiotic Recombination, organism-specific biosystem; Meiotic Synapsis, organism-specific biosystem; Packaging Of Telomere Ends, organism-specific biosystem;
Function DNA binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HIST3H3 Products

Required fields are marked with *

My Review for All HIST3H3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon