"HIST3H3" Related Products

Expand

Recombinant Human HIST3H3 protein, His-tagged

Cat.No.: HIST3H3-299H
Product Overview: Recombinant Human HIST3H3(2–136 aa) fused with N-terminal Met-Ala-Cys-6xHis-tag was expressed in E. coli.
Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.
Source: E. coli
Species: Human
Tag: His
Form: 8 mM PBS pH 7.4, 110 mM NaCl, 2.2 mM KCl, 20% glycerol and 3 mM DTT.
Molecular Mass: 16.3 kDa
AA Sequence: MACHHHHHHARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLP FQRLVREIAQDFKTDLRFQSSAVMALQEAAEAYLVGLFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
Applications: Useful as a substrate for histone methyltransferase and acetyltransferase assays. Ideal for screening small molecular inhibitors of histone modifying enzymes for drug discovery and HTS applications.
Storage: > 6 months at -80 centigrade. Avoid freeze/thaw cycles.
Concentration: 0.10 mg/ml
Gene Name: HIST3H3 histone cluster 3, H3 [ Homo sapiens ]
Official Symbol: HIST3H3
Synonyms: HIST3H3; histone cluster 3, H3; H3 histone family, member T , H3FT, histone 3, H3; histone H3.1t; H3/g; H3t; H3/t; histone 3, H3; H3 histone family, member T; H3.4; H3FT; MGC126886; MGC126888;
Gene ID: 8290
mRNA Refseq: NM_003493
Protein Refseq: NP_003484
MIM: 602820
UniProt ID: Q16695
Chromosome Location: 1q42.13
Pathway: Cell Cycle, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; EGFR1 Signaling Pathway, organism-specific biosystem; Meiosis, organism-specific biosystem; Meiotic Recombination, organism-specific biosystem; Meiotic Synapsis, organism-specific biosystem; Packaging Of Telomere Ends, organism-specific biosystem;
Function: DNA binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.