Recombinant Human HLA-A protein, His-tagged
Cat.No. : | HLA-A-3396H |
Product Overview : | Recombinant Human HLA-A protein(28-303 aa), fused to His tag, was expressed in E. coli. |
Availability | September 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 28-303 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQ |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HLA-A major histocompatibility complex, class I, A [ Homo sapiens ] |
Official Symbol | HLA-A |
Synonyms | HLA-A; major histocompatibility complex, class I, A; HLA class I histocompatibility antigen, A-1 alpha chain; antigen presenting molecule; leukocyte antigen class I-A; MHC class I antigen HLA-A heavy chain; HLAA; FLJ26655; |
Gene ID | 3105 |
mRNA Refseq | NM_001242758 |
Protein Refseq | NP_001229687 |
UniProt ID | P01891 |
◆ Recombinant Proteins | ||
HLA-A-938H | Recombinant Human HLA-A protein, MYC/DDK-tagged | +Inquiry |
HLA-A-3557HF | Recombinant Full Length Human HLA-A Protein, GST-tagged | +Inquiry |
HLA-A-733H | Recombinant Human HLA-A0201 MAGE-A4 (GVYDGREHTV) complex protein, His-Avi-tagged | +Inquiry |
HLA-A-2390H | Recombinant Human HLA-A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HLA-A-1500H | Recombinant Human HLA-A protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-A-5503HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-A Products
Required fields are marked with *
My Review for All HLA-A Products
Required fields are marked with *