Recombinant Human HLA-DQB1

Cat.No. : HLA-DQB1-27714TH
Product Overview : Recombinant fragment of Human HLA DQw1 (aa 129-217) with a N terminal proprietary tag: predicted molecular weight 35.79 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 89 amino acids
Description : HLA-DQB1 belongs to the HLA class II beta chain paralogs. This class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and it contains six exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. Alternative splicing results in multiple transcript variants.
Molecular Weight : 35.790kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : PTVTISPSRTEALNHHNLLVCSVTDFYPAQIKVRWFRNDQEETTGVVSTPLIRNGDWTFQILVMLEMTPQRGDVYTCHVEHPSLQNPII
Gene Name HLA-DQB1 major histocompatibility complex, class II, DQ beta 1 [ Homo sapiens ]
Official Symbol HLA-DQB1
Synonyms HLA-DQB1; major histocompatibility complex, class II, DQ beta 1; HLA DQB; HLA class II histocompatibility antigen, DQ beta 1 chain; CELIAC1; IDDM1;
Gene ID 3119
mRNA Refseq NM_001243961
Protein Refseq NP_001230890
MIM 604305
Uniprot ID P01920
Chromosome Location 6p21.3
Pathway Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem;
Function MHC class II receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HLA-DQB1 Products

Required fields are marked with *

My Review for All HLA-DQB1 Products

Required fields are marked with *

0
cart-icon