Recombinant Human HLA-DRB3, GST-tagged

Cat.No. : HLA-DRB3-1210H
Product Overview : Recombinant Human HLA-DRB3 encod-ing human HLA-DRB3 full-length ORF (1 a.a. - 266 a.a.) fused with GST-tag at N-terminal was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1-266 a.a.
Description : HLA-DRB3 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB3 is linked with allelic variants of DRB1, otherwise it is omitted.
Molecular Mass : 55 kDa
Sequence : MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
Purification : Glutathione Sepharose 4 Fast Flow
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Stability : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol : HLA-DRB3
Gene Name HLA-DRB3 major histocompatibility complex, class II, DR beta 3 [ Homo sapiens ]
Synonyms HLA-DR3B; major histocompatibility complex, class II, DR beta 3; DR7; MHC class II antigen DRB3; human leucocyte antigen DRB3; MHC class II HLA-DR beta 3 chain; MHC class II antigen DR beta 3 chain; HLA class II histocompatibility antigen, DR beta 3 chain; HLA class II histocompatibility antigen, DRB1-7 beta chain
Gene ID 3125
mRNA Refseq NM_022555
Protein Refseq NP_072049
MIM 612735
UniProt ID P13761
Chromosome Location 6p21.3
Pathway Adaptive Immune System; Allograft rejection; Antigen processing and presentation; Asthma; Autoimmune thyroid disease; Cell adhesion molecules (CAMs)
Function MHC class II receptor activity; peptide antigen binding; protein binding; MHC class II receptor activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HLA-DRB3 Products

Required fields are marked with *

My Review for All HLA-DRB3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon