Recombinant Human HLA-G Protein

Cat.No. : HLA-G-1241H
Product Overview : Recombinant Human HLA-G Protein (25-338aa) was expressed in mammalian cells with N-terminal His-tag.
Availability November 03, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 25-338 a.a.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 39.6 kDa
AA Sequence : GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name HLA-G major histocompatibility complex, class I, G [ Homo sapiens ]
Official Symbol HLA-G
Synonyms HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G
Gene ID 3135
mRNA Refseq NM_002127
Protein Refseq NP_002118
MIM 142871
UniProt ID P17693

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HLA-G Products

Required fields are marked with *

My Review for All HLA-G Products

Required fields are marked with *

0
cart-icon
0
compare icon