Recombinant Human HLA-G Protein
| Cat.No. : | HLA-G-1241H |
| Product Overview : | Recombinant Human HLA-G Protein (25-338aa) was expressed in mammalian cells with N-terminal His-tag. |
| Availability | February 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 25-338 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 39.6 kDa |
| AA Sequence : | GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | HLA-G major histocompatibility complex, class I, G [ Homo sapiens ] |
| Official Symbol | HLA-G |
| Synonyms | HLA-G; major histocompatibility complex, class I, G; HLA G histocompatibility antigen, class I, G; HLA class I histocompatibility antigen, alpha chain G; b2 microglobulin; HLA G antigen; HLA class I molecule; MHC class I antigen G; HLA-G histocompatibility antigen, class I, G; MHC-G |
| Gene ID | 3135 |
| mRNA Refseq | NM_002127 |
| Protein Refseq | NP_002118 |
| MIM | 142871 |
| UniProt ID | P17693 |
| ◆ Recombinant Proteins | ||
| HLA-G-504H | Recombinant Human HLA-G protein, His-Avi-tagged, Biotinylated | +Inquiry |
| HLA-G-506R | Recombinant Rhesus macaque HLA-G protein, His-Avi-tagged | +Inquiry |
| HLA-G-3322H | Recombinant Human HLA-G protein, His-tagged | +Inquiry |
| HLA-G-505C | Recombinant Cynomolgus HLA-G Tetramer protein, His-Avi-tagged | +Inquiry |
| HLA-G-651HF | Recombinant Full Length Human HLA-G Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HLA-G-5493HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HLA-G Products
Required fields are marked with *
My Review for All HLA-G Products
Required fields are marked with *
