"HMBS" Related Products

Expand

Recombinant Human HMBS protein, His-tagged

Cat.No.: HMBS-39H
Product Overview: Recombinant Human HMBS(Ser2-His361) fused with His tag at C-terminal was expressed in HEK293.
Description: Porphobilinogen Deaminase (HMBS) is a member of the HMBS family. PBGD is the third enzyme of the heme biosynthetic pathway and catalyzes the head to tail condensation of four porphobilinogen molecules into the linear hydroxymethylbilane. HMBS is involved in the production of heme, which is important for all of the body's organs, although it is most abundant in the blood, bone marrow, and liver. In addition, Heme is an essential component of iron-containing proteins called hemoproteins, including hemoglobin. Defects in PBGD are the cause of acute intermittent porphyria.
Source: HEK293
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
AA Sequence: SGNGNAAATAEENSPKMRVIRVGTRKSQLARIQTDSVVATLKASYPGLQFEIIAMSTTGDKILDT ALSKIGEKSLFTKELEHALEKNEVDLVVHSLKDLPTVLPPGFTIGAICKRENPHDAVVFHPKFVG KTLETLPEKSVVGTSSLRRAAQLQRKFPHLEFRSIRGNLNTRLRKLDEQQEFSAIILATAGLQRM GWHNRVGQILHPEECMYAVGQGALGVEVRAKDQDILDLVGVLHDPETLLRCIAERAFLRHLEGGC SVPVAVHTAMKDGQLYLTGGVWSLDGSDSIQETMQATIHVPAQHEDGPEDDPQLVGITARNIPRG PQLAAQNLGISLANLLLSKGAKNILDVARQLNDAHVDHHHHHH
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks.Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days.Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months.
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in ddH2O.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: HMBS hydroxymethylbilane synthase [ Homo sapiens ]
Official Symbol: HMBS
Synonyms: HMBS; hydroxymethylbilane synthase; PBGD, PORC, porphobilinogen deaminase , porphyria, acute; Chester type , UPS, uroporphyrinogen I synthase; porphobilinogen deaminase; uroporphyrinogen I synthase; pre-uroporphyrinogen synthase; uroporphyrinogen I synthetase; porphyria, acute; Chester type; UPS; PBGD; PORC; PBG-D;
Gene ID: 3145
mRNA Refseq: NM_000190
Protein Refseq: NP_000181
MIM: 609806
UniProt ID: P08397
Chromosome Location: 11q23.2-qter
Pathway: Heme Biosynthesis, organism-specific biosystem; Heme biosynthesis, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of porphyrins, organism-specific biosystem; Porphyrin and chlorophyll metabolism, organism-specific biosystem; Porphyrin and chlorophyll metabolism, conserved biosystem;
Function: amine binding; carboxylic acid binding; coenzyme binding; hydroxymethylbilane synthase activity; hydroxymethylbilane synthase activity; transferase activity; uroporphyrinogen-III synthase activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.